CAZyme Information: PHYCI_21404T0-p1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: PHYCI_21404T0-p1
• CAZy Family: CE8
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
270		29770.38	4.4084

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiCBS144-22	26201	1048749	70	26131

• Gene Location: location=PcinCBS144-22_SC0425:15977-16789(+)

Full Sequence      

MLQDEEDRVSIDGVQSGHATPDPTSKFTPAVGWDSTKNYENIAEMRDKFTGPVLDLENHY
EGAHDSFSLTRPIWNSSEVRTGLYHGVYGGAAGFTYGANSVWQMYEPRSDLVSDAVYYDP
QINQNATGSWRRDIFFEGASQIQYVTKPLQNLTTTILESLEPARELLASPSDHTGKSVNT
YEGTRYISVLASKSRDRYYVYTGHGDSFSLQLDNGSGARTGSATWFSPRDGQYSANSTVS
VPESGNGTRVDFTPPSGGSVDDDWLLVLEL

Enzyme Prediction     

No EC number prediction in PHYCI_21404T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH140	7	240	1.8e-32	0.4830097087378641

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404153	DUF4038	4.05e-39	5	152	192	320	Protein of unknown function (DUF4038). A family of putative cellulases.
403955	Collagen_bind_2	1.04e-12	179	269	10	92	Putative collagen-binding domain of a collagenase. This domain is likely to be the collagen-binding domain of a family of bacterial collagenase enzymes. It is the C-terminal part of the Structure 3kzs (information derived from TOPSAN).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KAF3763706.1|GH140	5.94e-65	8	270	274	537
KAF2142288.1|GH140	2.47e-62	9	270	272	535
KNX49908.1|GH140	3.86e-25	9	265	260	514
KAF2014171.1|GH140	7.30e-24	9	269	252	484
KAE8156220.1|GH140	8.41e-24	9	270	267	509

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MSY_A	6.88e-09	52	268	259	444	Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_B Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_C Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482]
3KZS_A	1.66e-08	52	268	259	444	Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_B Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_C Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_D Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

PHYCI_21404T0-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000053	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PHYCI_21404T0-p1.