CAZyme Information: PHYCI_213244T0-p1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: PHYCI_213244T0-p1
• CAZy Family: CE8
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
569	PcinCBS144-22_SC0010|CGC1	62029.15	5.8910

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiCBS144-22	26201	1048749	70	26131

• Gene Location: location=PcinCBS144-22_SC0010:662370-664079(-)

Full Sequence      

MGFGLLSVLSVYTTVLLALHTGSGTADVVTFNWRVTEITAVFDGIPRPMLGINNKPSDQA
VIDVKLGQEVEVRVTNELAVPTCLHWHGLNQPGTQEMDGTSGVTQCHISPNGTAVYHFIP
EKAGTFWWHSHESSQFAFGLRGPLIVRAPVDKQQAWEKDIAGEYIVQLADYYHAEPGAVR
MWDTMLINNRGRYNCTAAASHGFKDCSDNQPLARFRFEAGKNYLLRLVNMAALSPIVFSI
DDHEFQVVAADSEPLQPSRFINSITLNCGHRYDLLVRAKTASVRGPNDGKVGSFWMRATG
LHGLPWTRGTAATAGEGYNYEGLAVVSYDAEDGAEPTSKASAIAATVGEFEFNPLVPNTL
PAVPADRTVLEFKMQSALGHFAIDGGEYHHFVAPSEPPLFTIASGLKTEQLPVEANARKI
EYGKHIEVVLVNVKDEQHPFHMHGHAPWVVGSGVASIDDIRNNSLPPLKLVDPMMRDVYT
VPQCTSDGNGGCKDAGYVVLRFNADNPGVWIMHCHIDWHLIAGLGMIFVEGEEQLQQMGV
NAFSNSMLSVCGGKHDANTTSTLPPPSTS

Enzyme Prediction     

No EC number prediction in PHYCI_213244T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA1	46	524	2.8e-84	0.9748603351955307

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
274555	ascorbase	1.23e-60	28	535	1	528	L-ascorbate oxidase, plant type. Members of this protein family are the copper-containing enzyme L-ascorbate oxidase (EC 1.10.3.3), also called ascorbase. This family is found in flowering plants, and shows greater sequence similarity to a family of laccases (EC 1.10.3.2) from plants than to other known ascorbate oxidases.
215324	PLN02604	4.24e-54	62	534	57	550	oxidoreductase
177843	PLN02191	1.92e-51	11	531	8	547	L-ascorbate oxidase
274556	laccase	3.21e-48	30	538	7	529	laccase, plant. Members of this protein family include the copper-containing enzyme laccase (EC 1.10.3.2), often several from a single plant species, and additional, uncharacterized, closely related plant proteins termed laccase-like multicopper oxidases. This protein family shows considerable sequence similarity to the L-ascorbate oxidase (EC 1.10.3.3) family. Laccases are enzymes of rather broad specificity, and classification of all proteins scoring about the trusted cutoff of this model as laccases may be appropriate.
225043	SufI	2.22e-47	2	533	7	451	Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) [Cell cycle control, cell division, chromosome partitioning, Inorganic ion transport and metabolism, Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFY09916.1|AA1	2.03e-290	10	552	7	545
UIZ26488.1|AA1	1.75e-268	16	565	4	547
AFY09915.1|AA1	2.78e-201	13	553	6	567
UIZ26495.1|AA1	1.56e-192	28	553	23	563
AIG56347.1|AA1_2	2.84e-89	29	553	42	556

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5Z1X_A	3.20e-64	43	534	18	469	Crystal Structure of Laccase from Cerrena sp. RSD1 [Cerrena],5Z1X_B Crystal Structure of Laccase from Cerrena sp. RSD1 [Cerrena],5Z22_A Crystal Structure of Laccase from Cerrena sp. RSD1 [Cerrena]
1HFU_A	4.05e-62	71	530	45	468	Chain A, LACCASE 1 [Coprinopsis cinerea]
1A65_A	4.14e-62	71	530	45	468	Chain A, Laccase [Coprinopsis cinerea]
1V10_A	8.66e-59	82	558	82	514	Chain A, Laccase [Rigidoporus microporus]
6RHH_A	1.02e-58	34	530	10	469	Single crystal serial study of the X-ray induced enzymatic reduction of molecular oxygen to water for laccase from Steccherinum murashkinskyi at sub-atomic resolution. Third structure of the series with 315 KGy dose. [Steccherinum murashkinskyi],6RHI_A Single crystal serial study of the X-ray induced enzymatic reduction of molecular oxygen to water for laccase from Steccherinum murashkinskyi at sub-atomic resolution. Ninth structure of the series with 1215 KGy dose. [Steccherinum murashkinskyi],6RHO_A Single crystal serial study of the X-ray induced enzymatic reduction of molecular oxygen to water for laccase from Steccherinum murashkinskyi at sub-atomic resolution. Twentieth structure of the series with 4065 KGy dose. [Steccherinum murashkinskyi],6RHP_A Single crystal serial study of the X-ray induced enzymatic reduction of molecular oxygen to water for laccase from Steccherinum murashkinskyi at sub-atomic resolution. Twenty first structure of the series with 4415 KGy dose (collected after refreezing). [Steccherinum murashkinskyi],6RHR_A Single crystal serial study of the inhibition of laccases from Steccherinum murashkinskyi by chloride anions at sub-atomic resolution. First structure of the series with 15 KGy dose. [Steccherinum murashkinskyi],6RHU_A Single crystal serial study of the inhibition of laccases from Steccherinum murashkinskyi by chloride anions at sub-atomic resolution. Second structure of the series with 165 KGy dose. [Steccherinum murashkinskyi],6RHX_A Single crystal serial study of the inhibition of laccases from Steccherinum murashkinskyi by chloride anions at sub-atomic resolution. Third structure of the series with 315 KGy dose. [Steccherinum murashkinskyi],6RI0_A Single crystal serial study of the inhibition of laccases from Steccherinum murashkinskyi by chloride anions at sub-atomic resolution. Ninth structure of the series with 1215 KGy dose. [Steccherinum murashkinskyi],6RI2_A Single crystal serial study of the inhibition of laccases from Steccherinum murashkinskyi by chloride anions at sub-atomic resolution. Twentieth structure of the series with 4065 KGy dose. [Steccherinum murashkinskyi],6RI4_A Single crystal serial study of the inhibition of laccases from Steccherinum murashkinskyi by fluoride anions at sub-atomic resolution. First structure of the series with 13 KGy dose. [Steccherinum murashkinskyi],6RI6_A Single crystal serial study of the inhibition of laccases from Steccherinum murashkinskyi by fluoride anions at sub-atomic resolution. Second structure of the series with 400 KGy dose. [Steccherinum murashkinskyi],6RI8_A Single crystal serial study of the inhibition of laccases from Steccherinum murashkinskyi by fluoride anions at sub-atomic resolution. Third structure of the series with 800 KGy dose. [Steccherinum murashkinskyi],6RII_A Single crystal serial study of the inhibition of laccases from Steccherinum murashkinskyi by fluoride anions at sub-atomic resolution. Fourth structure of the series with 1200 KGy dose. [Steccherinum murashkinskyi],6RIK_A Single crystal serial study of the inhibition of laccases from Steccherinum murashkinskyi by fluoride anions at sub-atomic resolution. Thirteenth structure of the series with 5200 KGy dose. [Steccherinum murashkinskyi],6RIL_A Single crystal serial study of the inhibition of laccases from Steccherinum murashkinskyi by fluoride anions at sub-atomic resolution. Fourteenth structure of the series with 5600 KGy dose (data was collected after refreezing). [Steccherinum murashkinskyi]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q02497|LAC1_TRAHI	8.38e-59	25	530	26	490	Laccase OS=Trametes hirsuta OX=5327 PE=1 SV=1
sp|E9R598|FETC_ASPFU	4.75e-57	2	537	4	499	Iron transport multicopper oxidase fetC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=fetC PE=2 SV=1
sp|Q12570|LAC1_BOTFU	1.37e-56	21	535	54	526	Laccase-1 OS=Botryotinia fuckeliana OX=40559 GN=lcc1 PE=2 SV=3
sp|Q12542|LAC2_AGABI	2.26e-56	15	533	8	490	Laccase-2 OS=Agaricus bisporus OX=5341 GN=lcc2 PE=1 SV=1
sp|J9VQZ4|LAC2_CRYNH	1.77e-55	31	538	64	568	Laccase-2 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=LAC2 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.033061	0.966911	CS pos: 24-25. Pr: 0.5354

TMHMM  Annotations     

There is no transmembrane helices in PHYCI_213244T0-p1.