CAZyme Information: PHYCI_212790T0-p1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: PHYCI_212790T0-p1
• CAZy Family: CE8
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
558		61700.60	5.7394

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiCBS144-22	26201	1048749	70	26131

• Gene Location: location=PcinCBS144-22_SC0010:657223-658899(-)

Full Sequence      

MRVAHAPVFAAALLALHLGASAADLVTYDWRVTNLTVEYDGVFIHSLGINDKPADQAVID
VELGQDVEVRVTNELNEPTCLHWHGLKQLGTQEMDGTSEITQCHISPNSTAIYRFTPDKA
GTFWWHSHHMAQYAYGLRGPLVVHAPATERQAWEKDIDGEYVIQLADLYHRPPQPTRMWD
NILINNRGRYNCIAAAHHNFTQCTEEQPLSKFNFVPGNKYLLRLINMAALSPIVFSIDDH
EFQVVAADGDHLQPCKFINSIQLNAGQRYDIIVQAKAASEQNQETAFWMRANGLHGLPWT
RGTAAIAGEGYTYEGLAIVSYGSESEAEPTTTKQANLTTVNEFDFMPLVPIALPQTASDR
AVLEFKMQDGKGHFAIDGGAYHHFTHPEEPPLFTIAGGLKTEQLPVEANARKIEYGKHIE
VVLVNVKDEQHPFHMHTHSPWVVGSGVASIDAIRNNQLPALKLLNPMTRDVYTVPPCTSD
GNGGCLDAGYLVLRFNADNPGVWIFHCHIDWHLEAGLSMMLVEGEDELQKKGVAAFSNAI
LSVCGANSRFGNGTALQS

Enzyme Prediction     

EC	1.10.3.2:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA1	57	517	1.9e-89	0.9385474860335196

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
274555	ascorbase	4.47e-67	28	530	4	530	L-ascorbate oxidase, plant type. Members of this protein family are the copper-containing enzyme L-ascorbate oxidase (EC 1.10.3.3), also called ascorbase. This family is found in flowering plants, and shows greater sequence similarity to a family of laccases (EC 1.10.3.2) from plants than to other known ascorbate oxidases.
215324	PLN02604	1.14e-56	59	530	57	553	oxidoreductase
225043	SufI	1.67e-56	58	522	65	445	Multicopper oxidase with three cupredoxin domains (includes cell division protein FtsP and spore coat protein CotA) [Cell cycle control, cell division, chromosome partitioning, Inorganic ion transport and metabolism, Cell wall/membrane/envelope biogenesis].
177843	PLN02191	1.74e-56	59	530	56	553	L-ascorbate oxidase
274556	laccase	7.61e-49	59	530	36	528	laccase, plant. Members of this protein family include the copper-containing enzyme laccase (EC 1.10.3.2), often several from a single plant species, and additional, uncharacterized, closely related plant proteins termed laccase-like multicopper oxidases. This protein family shows considerable sequence similarity to the L-ascorbate oxidase (EC 1.10.3.3) family. Laccases are enzymes of rather broad specificity, and classification of all proteins scoring about the trusted cutoff of this model as laccases may be appropriate.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFY09916.1|AA1	0.0	10	550	10	550
UIZ26488.1|AA1	1.97e-302	13	550	4	542
AFY09915.1|AA1	7.47e-196	13	547	9	568
UIZ26495.1|AA1	2.61e-193	1	550	1	567
AIG55536.1|AA1	5.23e-89	24	533	39	545

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1HFU_A	2.16e-64	68	523	45	468	Chain A, LACCASE 1 [Coprinopsis cinerea]
1A65_A	2.21e-64	68	523	45	468	Chain A, Laccase [Coprinopsis cinerea]
5Z1X_A	2.50e-64	64	527	41	469	Crystal Structure of Laccase from Cerrena sp. RSD1 [Cerrena],5Z1X_B Crystal Structure of Laccase from Cerrena sp. RSD1 [Cerrena],5Z22_A Crystal Structure of Laccase from Cerrena sp. RSD1 [Cerrena]
1V10_A	6.80e-60	21	523	19	489	Chain A, Laccase [Rigidoporus microporus]
5NQ7_A	4.64e-59	13	523	12	488	Crystal structure of laccases from Pycnoporus sanguineus, izoform I [Trametes sanguinea]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|E9R598|FETC_ASPFU	9.93e-66	18	530	16	499	Iron transport multicopper oxidase fetC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=fetC PE=2 SV=1
sp|Q12570|LAC1_BOTFU	2.04e-63	32	528	69	526	Laccase-1 OS=Botryotinia fuckeliana OX=40559 GN=lcc1 PE=2 SV=3
sp|A0A067XMP2|PTAK_PESFW	3.37e-62	27	528	66	553	Oxydoreductase ptaK OS=Pestalotiopsis fici (strain W106-1 / CGMCC3.15140) OX=1229662 GN=ptaK PE=2 SV=2
sp|Q09920|FIO1_SCHPO	6.71e-60	28	526	27	500	Iron transport multicopper oxidase fio1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=fio1 PE=3 SV=1
sp|O59896|LAC1_PYCCI	3.32e-58	13	523	12	488	Laccase OS=Pycnoporus cinnabarinus OX=5643 GN=LCC3-1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000226	0.999766	CS pos: 22-23. Pr: 0.9775

TMHMM  Annotations     

There is no transmembrane helices in PHYCI_212790T0-p1.