CAZyme Information: PHYCI_212761T0-p1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: PHYCI_212761T0-p1
• CAZy Family: CE8
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
455		48596.14	6.5693

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiCBS144-22	26201	1048749	70	26131

• Gene Location: location=PcinCBS144-22_SC0010:284005-285372(+)

Full Sequence      

MKAYGVIAQTTVFTALLIARSIADVIHTGQALGFAAGTTGGGSATPDYPATIEELKHLLS
DDQPRVIVLDKEFNFVGTEGTITETGCRPRAHTECLAKNNGFKGQDVILFPGDTTLTHTG
GCDQQVKVQVTYDKATKDALFVSSNKTLRGIDQKGILRGKGLWLDGDNIIIQNIHITELN
PQYVWGGDAIYLQGMEDRAMKNIWLDHIKISRVGRQMFVSGFAGVDSLTISNSDFDGRTE
FSTSCDGRHYWGFILDGTTTRVSFLNNYIHETSGRSPKIVGASSPNANVVAHIANNYWAD
NSGHSFEPGANAFVLAEGNYFDDTVEPVLADESKSSISTADDCRAALGRACSANVLEKCG
AFDSVNGGRALDALKQYKAIAGYIPAKASQLAKSSTNFGVGDLGDSPIQGNVKQGNGSPS
PKTTARKGGNKTKKKSGEDNSADAVQQENSAKNHS

Enzyme Prediction     

EC	4.2.2.10:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	129	322	1.5e-80	0.9893048128342246

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	1.13e-34	127	324	1	189	Amb_all domain.
226384	PelB	3.46e-14	134	403	91	344	Pectate lyase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHX74068.1|PL1_4	4.60e-153	24	403	20	399
ADN18834.1|PL1_4	8.62e-151	24	403	20	399
ADN18833.1|PL1_4	2.13e-146	9	403	5	399
ACR19248.1|PL1_4	1.61e-137	46	403	133	490
ACR19247.1|PL1_4|4.2.2.10	6.77e-135	24	403	20	398

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QCX_A	2.56e-76	29	360	5	320	Pectin Lyase B [Aspergillus niger]
1IDK_A	5.61e-75	28	390	4	356	Pectin Lyase A [Aspergillus niger]
1IDJ_A	6.79e-73	28	390	4	356	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CZD4|PELF2_ASPTN	6.30e-94	9	368	1	347	Probable pectin lyase F-2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pelF-2 PE=3 SV=1
sp|Q8NJK6|PELF_ASPNG	4.91e-92	14	360	11	342	Probable pectin lyase F OS=Aspergillus niger OX=5061 GN=pelF PE=3 SV=1
sp|A2R6A1|PELF_ASPNC	4.91e-92	14	360	11	342	Probable pectin lyase F OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pelF PE=3 SV=1
sp|B8N316|PELF_ASPFN	1.35e-91	29	360	25	341	Probable pectin lyase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pelF PE=3 SV=1
sp|Q2UJA7|PELF_ASPOR	1.35e-91	29	360	25	341	Probable pectin lyase F OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pelF PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000914	0.999068	CS pos: 23-24. Pr: 0.9605

TMHMM  Annotations     

There is no transmembrane helices in PHYCI_212761T0-p1.