CAZyme Information: PHYCI_212450T0-p1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: PHYCI_212450T0-p1
• CAZy Family: CE8
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
345	PcinCBS144-22_SC0009|CGC4	37224.63	6.6285

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiCBS144-22	26201	1048749	70	26131

• Gene Location: location=PcinCBS144-22_SC0009:648274-649389(-)

Full Sequence      

MQLFEPLVVLASLASVALADAACSGPNARVQPPAGAVIVDATGAHPGSYKTVSEGVANVI
NDTAEHTVFVFPGVYQEQVIVPKFNGPLVLQGYTCNTQSYADNQVTITHSMTQKDLPANA
TGSANQLVSTMLFRSKNGTKVYNLNVANPQVKLKSGGQAPAVFVNAPNHGFYACNMTGYQ
DTLCANRGPQLYAKNYINGAVDFIFGLLSKSWFESCDLESIGNGSITANGNGNSSNLSEY
VINNARVFGHFNKSSAYLGRPWYPYARVVFQNSELGDVLNPKGWNQWNKDNNTANVYFKE
FNNRGPGAGIGKRVSFSGQLDAAVPITDILGDDYESQWYVDKAFL

Enzyme Prediction     

EC	3.1.1.11:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	39	321	7.3e-66	0.9340277777777778

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178113	PLN02497	6.05e-43	34	323	31	309	probable pectinesterase
178372	PLN02773	4.53e-41	31	320	1	282	pectinesterase
178051	PLN02432	3.40e-40	33	327	9	282	putative pectinesterase
395871	Pectinesterase	4.33e-40	40	318	1	276	Pectinesterase.
215367	PLN02682	4.34e-38	33	329	67	358	pectinesterase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACO54875.1|CE8	5.43e-173	1	345	1	346
ACO54874.1|CE8	3.12e-156	6	345	7	348
ACO54873.1|CE8	5.34e-154	6	345	7	344
ACO54869.1|CE8	8.40e-154	1	345	1	338
ABQ63096.1|CE8	8.78e-153	6	345	7	344

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1C_A	6.10e-52	27	344	1	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	8.59e-52	27	344	1	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
1XG2_A	9.69e-26	47	318	13	279	Chain A, Pectinesterase 1 [Solanum lycopersicum]
1GQ8_A	5.04e-25	37	318	9	283	Pectin methylesterase from Carrot [Daucus carota]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12535|PME_ASPAC	2.19e-70	29	344	20	330	Pectinesterase OS=Aspergillus aculeatus OX=5053 GN=pme1 PE=2 SV=1
sp|P17872|PME_ASPNG	7.58e-65	13	345	6	330	Pectinesterase OS=Aspergillus niger OX=5061 GN=pme1 PE=1 SV=1
sp|Q4WBT5|PMEA_ASPFU	9.03e-58	29	344	28	324	Probable pectinesterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pmeA PE=3 SV=1
sp|B0Y9F9|PMEA_ASPFC	9.03e-58	29	344	28	324	Probable pectinesterase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pmeA PE=3 SV=1
sp|B8NPS7|PMEA_ASPFN	2.38e-54	12	344	9	324	Probable pectinesterase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000221	0.999743	CS pos: 19-20. Pr: 0.9736

TMHMM  Annotations     

There is no transmembrane helices in PHYCI_212450T0-p1.