CAZyme Information: PHYCI_212180T0-p1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: PHYCI_212180T0-p1
• CAZy Family: CE8
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
349	PcinCBS144-22_SC0009|CGC4	37820.51	8.5328

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiCBS144-22	26201	1048749	70	26131

• Gene Location: location=PcinCBS144-22_SC0009:618516-619638(+)

Full Sequence      

MQFFAPLVILATLASGALAGAGGGVKCSGPNARVRPPKGAIVVDATGAHPGSYKTVSEGV
ANIPNTTAEHTLFVFPGVYQEQVVVPRFNGPIVLQGYTCNTQSYAHNQVTITHSMAQKDL
PANTTGSLNQLVSTMLFRSKNGTRVYNLNVANPEPKIKNLGQAIAVYVDGPKHGFYACNM
TGYQDTLCANKGPQLYAKSYINGAVDFIFGLLSKSWFESCDIESIGNGSITANGNGNSSN
LSEYVINNARVFGHYNKSAAYLGRPWFPYARVVFQNSELGDVINPQGWQKWNKDNNTANV
YFKEFNNRGPGAATDERVSFSGQLDAAVPITDILGDDYKSQWYVDKKFL

Enzyme Prediction     

EC	3.1.1.11:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	42	326	4.6e-70	0.9409722222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178051	PLN02432	6.38e-44	41	331	13	282	putative pectinesterase
395871	Pectinesterase	3.59e-43	44	322	1	276	Pectinesterase.
178113	PLN02497	3.87e-43	41	327	34	309	probable pectinesterase
178372	PLN02773	9.45e-43	48	324	10	282	pectinesterase
215357	PLN02665	1.45e-41	51	325	78	341	pectinesterase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACO54875.1|CE8	1.10e-180	1	349	1	346
ACO54873.1|CE8	1.91e-162	1	349	1	344
ACO54874.1|CE8	1.22e-161	6	349	7	348
ABQ63096.1|CE8	3.14e-161	1	349	1	344
ACO54869.1|CE8	2.00e-160	1	349	1	338

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1C_A	6.83e-52	33	348	3	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	9.61e-52	33	348	3	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
1GQ8_A	4.39e-29	41	322	9	283	Pectin methylesterase from Carrot [Daucus carota]
1XG2_A	2.17e-28	51	322	13	279	Chain A, Pectinesterase 1 [Solanum lycopersicum]
4PMH_A	2.09e-08	53	312	48	366	The structure of rice weevil pectin methyl esterase [Sitophilus oryzae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12535|PME_ASPAC	3.96e-72	33	348	20	330	Pectinesterase OS=Aspergillus aculeatus OX=5053 GN=pme1 PE=2 SV=1
sp|P17872|PME_ASPNG	1.53e-65	33	349	20	330	Pectinesterase OS=Aspergillus niger OX=5061 GN=pme1 PE=1 SV=1
sp|Q4WBT5|PMEA_ASPFU	3.64e-58	33	340	28	318	Probable pectinesterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pmeA PE=3 SV=1
sp|B0Y9F9|PMEA_ASPFC	3.64e-58	33	340	28	318	Probable pectinesterase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pmeA PE=3 SV=1
sp|A1DBT4|PMEA_NEOFI	1.73e-55	33	340	28	318	Probable pectinesterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000188	0.999795	CS pos: 19-20. Pr: 0.9804

TMHMM  Annotations     

There is no transmembrane helices in PHYCI_212180T0-p1.