CAZyme Information: PHYCI_207302T0-p1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: PHYCI_207302T0-p1
• CAZy Family: CBM47
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
796		89282.31	5.3696

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiCBS144-22	26201	1048749	70	26131

• Gene Location: location=PcinCBS144-22_SC0002:575026-577416(+)

Full Sequence      

MKTSWWVRTALAVAAAARHAAASQNDPDVGEGFNFLHGTVESATEKLVGTLRPNTPPEAA
KQDSASGGYFAPFGTEAPSEELFQRNGSLAKLAPIINVAEEVLNQPVPTNKWWGNLIHVT
ATNRSENFPAWSNPYAFKLPKEAPFGLQTFYPYSYREMAPEVNGTVKWYTHGVHNDLTLS
AQEFFNSSKPNYEVYHWDDIGIKLRTCDKTNTSCMESALLSGMAFVSATYDGLTPRIDTE
HDIVDVDDSAPGKFVIHLNNSQTWVLYASDKSLSLRVEDSVVFSVNASGSSLVADTGYSG
TIRVALLPENADDTVYDEFASCMVRGGSVSMESRTRYSLHWDVEGSSCETVGLLHFALPH
QVESLTGSPTTSTSAGAIVMHSATRGEMVGQVTTTPTWSFVEPEADFEVDFYPARKPTPW
VVQQTDMLRTLQKDIMANWSLNANSWYFNGKYYQKYASLCLMAADSSVVGTDTTLLSYCL
EKLEAVIEPMLNNTQFPPLVYETLYSGIVSSQIFEHGWLYMDFGSGIYNDHHYHFGYYVT
ASAILKHLDPNWSRMPELERMIWTMLRDVANPSLKDHYFPRFRHFSWFHAHSYSRGVTLL
DNGKDEESTSEDINFYYGMTLWGKVSGNKAVEDLGSLMLRLNAHAIRTYFLLKSDNKVHP
PEIVRNHVTGIFFDNKVYYNTWFLDEKYAIHGIQMLPVSPINELARTSVFVAQEWNDILS
KENIVTMQNSNNSWLSLLLVNAATVNPMDSLRKLKNATMDDGLSRSWALYNAATRCRDDV
SIKGSVSKLQVAVDLY

Enzyme Prediction     

No EC number prediction in PHYCI_207302T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	98	770	3.7e-166	0.9807073954983923

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407548	Glyco_hydro81C	8.10e-126	431	769	18	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
227785	Acf2	7.95e-123	106	773	89	753	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
397619	Glyco_hydro_81	8.75e-46	106	413	14	318	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ26131.1|GH81	0.0	68	775	11	714
UIZ26137.1|GH81	0.0	68	775	121	824
UIZ26602.1|GH81	0.0	68	775	121	824
UIZ26438.1|GH81	0.0	59	775	34	740
UIZ26440.1|GH81	0.0	59	775	34	740

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	8.29e-94	107	775	41	718	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	1.41e-93	107	775	66	743	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	1.67e-89	107	775	41	718	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	3.46e-22	529	719	414	603	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	4.88e-22	106	763	48	667	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09850|ENG2_SCHPO	5.79e-87	106	773	34	700	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	4.94e-83	211	773	179	735	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|Q5AIR7|ENG1_CANAL	2.11e-79	66	773	425	1139	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1
sp|D4AZ24|ENG1_ARTBC	7.71e-78	106	773	225	900	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|P53753|ENG1_YEAST	1.69e-74	96	769	422	1106	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.649463	0.350551

TMHMM  Annotations     

There is no transmembrane helices in PHYCI_207302T0-p1.