CAZyme Information: PHYCI_207198T0-p1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: PHYCI_207198T0-p1
• CAZy Family: CBM13
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
966	PcinCBS144-22_SC0002|CGC1	105057.50	6.4943

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiCBS144-22	26201	1048749	70	26131

• Gene Location: location=PcinCBS144-22_SC0002:191354-194979(-)

Full Sequence      

MTGRSALLLLAVLAVAALQHLAAATAVDGVIVVRGNKLYNAKTGERFFIKGMTYEYAVSD
DYYDKYSKAAISENLSGLKYNTLRLYNINPTSSYKNFMNDMAALGVYVLVSASPDNDAYY
GKYRYSTITKSLSCSGKVSSGDGTKTVDQTETCYPALLLEYGKKIIQNFAQYDNTLGVVV
ANEIMQADLTAGSCVKAYVADLKNWMTVNGKKIRILPLAYAAADSSNNQISNADDYHVVK
IQGLLCGDKMTNGMMAESIDIYLINEYRWCPDSTFAEAYQRYINMAQGIPIVVAFGEYGC
KTSSATPRDWGMIPYLYQDPSKTDEFTAVWSGGLAYSYGEAKLASDSLFPMFTGGSTDFL
GTPSSKSSTDYTNLKAMFAKYSGYTDNAEWTDSTKCSWKPTVETKTQSTNTRATKYGWIV
SSCSASNLKISSSDSWTCSSREGVVCTDSGATCDVTLSSSVGTTQEDICGTYEVTSGGGT
CESTSDCGGNGQCKESNGTKSCSCLSCYTGTDCSVKDISSCATLSSSTSAPGTIFVGVGA
FLGVMAVVFIALGVAAAKKKAGTCLDHCAVLLCPATMPPKGKKTEEPTRTYLGRPGNNVK
IGIVGVPNVGKSTFFNCLSKLHIPAENFPFCTIDPNDAVVPLPDQRFNWLVDKYQPASVV
PPVISITDIAGLVRGAAEGAGLGNAFLSHIQAVDAIYHMVRAFDSTEVTHVEGNVDPVRD
MKIIQEELRLKDIERVTKECAGVKKLAERGVGGKEKKLEYESLCKIQEWLESGKDVSFGT
WSAQEVEILNQMQLLTAKPVVYLINVSKRDYLRKGNKYLPKIAEFIKERGGNEPVIPLSC
EFELEMLDLEAAGQLETYYKENPTHKSILNRVLKMGYSALGLIHFFTAGKDEVRGWTIRK
GRLAPQAAGVIHTDFEKGFIMAEVQAFADLKELGSEEAVKKAGKLKQQGKKYEVQDGDII
FFKFNN

Enzyme Prediction     

No EC number prediction in PHYCI_207198T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH72	30	378	2.6e-73	0.967948717948718

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
240334	PTZ00258	0.0	578	965	1	387	GTP-binding protein; Provisional
236583	PRK09601	1.56e-162	600	965	4	363	redox-regulated ATPase YchF.
223091	GTP1	3.33e-150	597	965	1	371	Ribosome-binding ATPase YchF, GTP1/OBG family [Translation, ribosomal structure and biogenesis].
206687	YchF	2.69e-129	601	880	1	274	YchF GTPase. YchF is a member of the Obg family, which includes four other subfamilies of GTPases: Obg, DRG, Ygr210, and NOG1. Obg is an essential gene that is involved in DNA replication in C. crescentus and Streptomyces griseus and is associated with the ribosome. Several members of the family, including YchF, possess the TGS domain related to the RNA-binding proteins. Experimental data and genomic analysis suggest that YchF may be part of a nucleoprotein complex and may function as a GTP-dependent translational factor.
129200	TIGR00092	7.33e-104	597	965	1	367	GTP-binding protein YchF. This predicted GTP-binding protein is found in a single copy in every complete bacterial genome, and is found in Eukaryotes. A more distantly related protein, separated from this model, is found in the archaea. It is known to bind GTP and double-stranded nucleic acid. It is suggested to belong to a nucleoprotein complex and act as a translation factor. [Unknown function, General]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ26083.1|GH72	0.0	1	966	1	1000
CCA15473.1|GH72	0.0	31	966	23	953
CCA22645.1|GH72	1.16e-214	31	559	332	850
CCA14303.1|GH72	1.99e-175	28	470	57	499
AIG55862.1|GH72	2.43e-145	31	515	22	500

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EE0_A	3.26e-144	576	965	1	388	Crystal structure of OsYchF1 at pH 6.5 [Oryza sativa Japonica Group],5EE1_A Crystal structure of OsYchF1 at pH 7.85 [Oryza sativa Japonica Group],5EE3_A Complex Structure Of Osychf1 With Amp-pnp [Oryza sativa Japonica Group],5EE3_B Complex Structure Of Osychf1 With Amp-pnp [Oryza sativa Japonica Group],5EE9_A Complex structure of OSYCHF1 with GMP-PNP [Oryza sativa Japonica Group],5EE9_B Complex structure of OSYCHF1 with GMP-PNP [Oryza sativa Japonica Group]
2OHF_A	3.25e-133	577	965	1	388	Crystal structure of human OLA1 in complex with AMPPCP [Homo sapiens]
1NI3_A	9.51e-122	582	963	4	388	Structure of the Schizosaccharomyces pombe YchF GTPase [Schizosaccharomyces pombe]
1JAL_A	9.41e-88	600	965	4	362	Ychf Protein (Hi0393) [Haemophilus influenzae],1JAL_B Ychf Protein (Hi0393) [Haemophilus influenzae]
2DWQ_A	1.07e-76	601	965	4	367	Thermus thermophilus YchF GTP-binding protein [Thermus thermophilus HB8],2DWQ_B Thermus thermophilus YchF GTP-binding protein [Thermus thermophilus HB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9SA73|OLA1_ARATH	8.16e-144	577	965	1	387	Obg-like ATPase 1 OS=Arabidopsis thaliana OX=3702 GN=YchF1 PE=1 SV=1
sp|Q6Z1J6|OLA1_ORYSJ	2.28e-143	577	965	1	387	Obg-like ATPase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=YCHF1 PE=1 SV=1
sp|B8BBN7|OLA1_ORYSI	1.78e-142	577	965	1	387	Obg-like ATPase 1 OS=Oryza sativa subsp. indica OX=39946 GN=OsI_28170 PE=3 SV=1
sp|Q8SWU7|OLA1_DROME	7.35e-135	577	965	1	386	Obg-like ATPase 1 OS=Drosophila melanogaster OX=7227 GN=CG1354 PE=1 SV=1
sp|Q5ZM25|OLA1_CHICK	3.92e-134	577	965	1	388	Obg-like ATPase 1 OS=Gallus gallus OX=9031 GN=OLA1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000188	0.999773	CS pos: 24-25. Pr: 0.9601

TMHMM  Annotations     

Start	End
5	27
534	556