CAZyme Information: PHYCI_20528T0-p1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: PHYCI_20528T0-p1
• CAZy Family: AA7
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1030	PcinCBS144-22_SC0325|CGC1	113095.30	6.4101

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiCBS144-22	26201	1048749	70	26131

• Gene Location: location=PcinCBS144-22_SC0325:30260-35186(-)

Full Sequence      

MSSTAVLQQKSATPRQRAPQLTLELSPASYSAAWFFIVITHAACGTFLICVAITYWFLTT
SIMPSFVSMWSLRGVQNYRFYGVVFGIVGAVHGIRVLNLVLIFVMVIIVPLTIFLPYIEE
FNIQYKSFTNPNFLFDPVPIVTMVLENRLIFTASLFDFTTKLIPQLSIMLSLFTVSELLG
RGDVKVIPVAEGPSTNYIESICVTRTYICASDRSDKKRAAFPTMASEDAQLNSFSNSLRN
RKERRKEPYKGRMPRLGLFMLATFASVAVFSAANETMTDQHVQDRVEELMSSMDLDTMLG
QMTQLDISTIMHPNRTLNRAIVHEHARLSVGSYLNTPGAELNDSNSNSTHNFSPKEWRDL
VRDIQDIYASHGSHPVLYGLDSVHGADYVRGAVLFGQQLNAAATFNPNLVYDMGRITARD
TAAAGIPWLFAPILEISQNPLWARTFETFGEDPHLVSVMADAIVRGIQSNGTTAACMKHI
IGYSKTPTGHDRAGVTVSDFDLLNHFAPSFLAAIKAGAMTAMESYISINGVPVVANTKIL
RDLVRHDMGFQGLIVTDYSEIHNLHVWHRVASTDQDAVRMALTNAPLDMSMVSYNTTFID
MARLTVQENPELLDRVKASARRIITTKVKLDLYENALPGTASDISLVGQNESRQAALELA
RESIVLLKNEDGLLPLSPDSDIFLTGHAADNVGLLCGGWSLRWQGVSGNSLFPNGISLRQ
GIANVLNTSSGSVQYANDLHPNGSYSSVALQFITNRAAQSKYTVIAIGEAAYAEKPGDLD
DLNLPRGQLDYVREIAATGTKVILVLAQGRPRLLQGLAELAHAVVYAMLPGELGGQALAE
ILFGRVNPSGRLPITYPKTPANIAIPYNHLVSTRCRDEGPCEMEWHFGHGLSYSVFEYGS
VSLSKNSICGSDDASLEVSVTVTNAGSMTGKETVMLFLIQPFRAISVPEIKQLKKFAKIH
LQPGETQVVSFTLTREDWGVFDPQVGSGFRRIVEPGSYFVAVKPETDCNVYNEGDAKSSG
LCAQFTIQDN

Enzyme Prediction     

EC	3.2.1.21:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	373	592	4e-58	0.9629629629629629

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	2.70e-113	253	1002	1	750	beta-glucosidase BglX.
224389	BglX	4.16e-64	353	713	42	385	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
178629	PLN03080	1.61e-54	389	973	108	742	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	1.16e-46	295	625	2	315	Glycosyl hydrolase family 3 N terminal domain.
396478	Glyco_hydro_3_C	2.16e-46	664	893	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ27116.1|GH3	0.0	302	1030	1	727
CCA27737.1|GH3	1.62e-288	285	1027	67	808
UIZ29009.1|GH3	1.00e-285	267	1027	16	762
UIZ29613.1|GH3	9.42e-262	256	1027	47	819
UIZ29432.1|GH3	2.87e-259	256	1027	2	763

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JP0_A	5.12e-118	278	977	9	718	Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus],5JP0_B Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus]
5XXL_A	6.38e-82	286	1028	14	752	Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	3.14e-81	286	1028	14	752	Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5M6G_A	8.12e-80	256	859	19	590	Crystal structure Glucan 1,4-beta-glucosidase from Saccharopolyspora erythraea [Saccharopolyspora erythraea D]
6R5I_A	7.75e-79	358	1002	55	718	Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q23892|GLUA_DICDI	1.76e-140	286	1002	80	811	Lysosomal beta glucosidase OS=Dictyostelium discoideum OX=44689 GN=gluA PE=1 SV=2
sp|A7LXU3|BGH3B_BACO1	3.77e-117	278	977	31	740	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1
sp|T2KMH0|PLH24_FORAG	4.14e-77	256	1002	7	706	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
sp|P33363|BGLX_ECOLI	2.42e-76	274	1002	26	750	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
sp|Q56078|BGLX_SALTY	1.17e-75	274	1002	26	750	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000007	0.000015

TMHMM  Annotations     

Start	End
35	57
77	94
96	118