CAZyme Information: PHYCI_20323T0-p1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: PHYCI_20323T0-p1
• CAZy Family: AA7
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
326		35031.10	7.0371

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiCBS144-22	26201	1048749	70	26131

• Gene Location: location=PcinCBS144-22_SC0312:673-1653(-)

Full Sequence      

MSVLAAVEASCSGSHTRTQPPSGAIVVDASGSYTGSVKTVAQGAAKLSDTTAEQTLFIFP
GTYREQVAIPQLNGPLVVQGYTCNTMSYSANQVTITHSMAQKDLAANVQSPNVVASTLYL
KSDSGVKVYNINVANTAGNVGQAVATYVDGATYGFYACKFMGYQDTLCANKGRELYARSF
ISGAVDFIFGLEAMAWFESCDIESVGAGCITANGNTGNSNPSEYVFNKARVYGSGRQTAY
LGRPWRPYARVVWQNSLLGNVINPEGWQTWDASTSNIFFREFNNTGRGAATTQRVSFSGR
LSGPVTIESTLGSNYKTEWWVDTMFL

Enzyme Prediction     

EC	3.1.1.11:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	25	299	6.7e-69	0.9305555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178113	PLN02497	3.49e-46	6	322	21	327	probable pectinesterase
178051	PLN02432	1.28e-40	25	302	13	273	putative pectinesterase
395871	Pectinesterase	1.69e-40	25	299	2	276	Pectinesterase.
178098	PLN02480	8.09e-39	61	302	85	320	Probable pectinesterase
215357	PLN02665	8.88e-39	113	302	144	341	pectinesterase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACO54875.1|CE8	1.54e-153	3	326	14	346
ACO54869.1|CE8	1.34e-152	3	326	13	338
AFM08806.1|CE8	9.31e-146	3	326	13	338
ACO54874.1|CE8	3.08e-144	4	326	19	348
ACO54873.1|CE8	1.50e-141	3	326	15	344

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1C_A	9.78e-59	16	325	2	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	1.38e-58	16	325	2	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
1GQ8_A	3.55e-34	16	299	2	283	Pectin methylesterase from Carrot [Daucus carota]
1XG2_A	9.87e-30	34	299	12	279	Chain A, Pectinesterase 1 [Solanum lycopersicum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12535|PME_ASPAC	4.22e-71	16	325	19	330	Pectinesterase OS=Aspergillus aculeatus OX=5053 GN=pme1 PE=2 SV=1
sp|P17872|PME_ASPNG	4.74e-70	16	326	19	330	Pectinesterase OS=Aspergillus niger OX=5061 GN=pme1 PE=1 SV=1
sp|A1DBT4|PMEA_NEOFI	1.72e-68	17	325	28	324	Probable pectinesterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pmeA PE=3 SV=1
sp|Q4WBT5|PMEA_ASPFU	6.86e-68	17	325	28	324	Probable pectinesterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pmeA PE=3 SV=1
sp|B0Y9F9|PMEA_ASPFC	6.86e-68	17	325	28	324	Probable pectinesterase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999771	0.000282

TMHMM  Annotations     

There is no transmembrane helices in PHYCI_20323T0-p1.