CAZyme Information: PHYCI_19262T0-p1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: PHYCI_19262T0-p1
• CAZy Family: AA6
• CAZyme Description: UDP-glucose:glycoprotein glucosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1672		187381.16	4.7581

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiCBS144-22	26201	1048749	70	26131

• Gene Location: location=PcinCBS144-22_SC0261:36091-41259(-)

Full Sequence      

MRLSTRLGAGLAALLVAAQPALTAARSVHVNLTASWPSSPFFPLMETSEFLAEENPLYFW
QFLEELEARTSYVDLMGSDVDALGTLAVTVAESIAPESKSILELMLAARTYSVKVEMFRQ
LALDSGVRPCGAEADTWAVFYREQHCVESVACSVDELEAVLKGKKQQAAEQSCVAAGVND
VELQVDHKYPNSVSDTEEKPLSAILYGLVGTDKFHAFHSKLVKQAQKDKIQYMVRHYPRD
SPLDTLLQGYGVALDIKNMEYKTIDDSKKTGEEDAAAAEEEAGEDDEEEDEEEIDDEEVE
GFLFNPLMARHGAISDELKQFYDVLVNKADSEQEQELKAWHLKDLGASAVRAVVDAKNPL
KRLETLSQDFPAQAKKLAFSRKSISSELCDEISATRMQAASRRLKNKFILNGIAVDPLER
SFNVFDFMKTLKEEWSVAKQLGGLPMNQSELEEMLAHVRETNQEQPVVRIHMRGSMGGST
PLYLNNIETDPNSANWSPDVDTLRRPSWNLVFVRKNMYECVLVLDPLTGTGRSALSHIGF
LRMRGAPVQWALLISSKELLASKTPDDRQTLLETYKSFKEADKATPWHFAKLLMLAQSKD
AADAEADEKESKGSQSGDEETSEAEEPMERIIPTRIASGFLQRVGENGDADVSVGSLIEA
YTDSAGGIGTLEENGEEAWSCMRSDRFDDEILAMTEFIHLKHVPLGSFVFNGVLQKNLDI
QRSMMPNFGRDQPIYVNMAHRGLLNDEMDLVEELLDAQDAYPAYLSIFEKSEGHPGDVEV
DLPKHLFADDVDGRLEAAVRPAISYLHAPGSRAVPKKQTVIFPADLNDPRDAGHAYRIVK
AVLEDSEQSLRAGIVPQLNSGSAGEGNNNVGELVAAIFAAVGDSDNENHLKFVLEALNCV
VKQKSVDAAKDKLLGIWDKLTKEKSDDAALKKVSALLRNKPGKWLTAKQRNALTQCNALL
RSRFPPVFAEESDEQESSKMALPHLFINGRRVTLPPQSLSDEDVDTIVSFDLKYRTQPVA
KALIKRSATLSAKQADSLSFEIMKTTGIVDKYVRTDRAPRINVGENSLNTVRLEGDPSLK
VAAYLDPLSEAAQVISSMLRMLHSQLNATIELVLIPADEYTEFPLQRFYRYLFDKKPSLA
ATHVEFRKLPVHPILTMKIETPEAWNVQTLHAGDDLDNLRVDPDSPTDIKSTTSAVFRLE
SLLVYGQCRDMTFNMYSPPNGLQLVLEREVGAQLLHRDTLVMKNLGYFQLQATPGVWSLH
LARGRAAELFDIIDPDTDLPLETHPVAVYDFGSHISQLFVRKKDGMEYEELLQSAEDATS
TDKPKPTTDAKTEKDDGALRSYWNSMLNMMGKQEGKSDKKIQDADTEVAHADSAEETSAV
GHQKVRTGETIHVFSVASGYLYERFVKIMMSSVLKRTNNPVTFWLLENFLSPDFKESIPA
LREEFGMDIRLVTYKWPNWLRQQTEKQRIIWGYKILFLDVLFPLGVQKIIYVDADQVVRA
DLKELWELDMEGKPYGYTPFCDSRNVGFQFWRQGYWKDHLRGKPYHISALYVVDLALFRQ
MAAGDMLRAVYSQLSADPNSLANLDQDLPNYAQHQIPIFSLPQEWLWCESWCSDETKAAA
KTIDLCNNPKHKEPKLDMAKRVIAGELFNESWIELDQEIKDAEAHYTVEAAA

Enzyme Prediction     

EC	2.4.1.-:29

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT24	1391	1636	1.2e-122	0.9959677419354839

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408203	Glyco_transf_24	0.0	1391	1661	1	267	Glucosyltransferase 24. This is the catalytic domain found in UDP-glucose:glycoprotein glucosyltransferase (UGGT). This domain belongs to glucosyltransferase 24 family (GT24) A-type domain. The GT domain displays the expected glycosyltransferase type A (GT-A) fold.
133054	GT8_HUGT1_C_like	1.39e-163	1391	1636	1	248	The C-terminal domain of HUGT1-like is highly homologous to the GT 8 family. C-terminal domain of glycoprotein glucosyltransferase (UGT). UGT is a large glycoprotein whose C-terminus contains the catalytic activity. This catalytic C-terminal domain is highly homologous to Glycosyltransferase Family 8 (GT 8) and contains the DXD motif that coordinates donor sugar binding, characteristic for Family 8 glycosyltransferases. GT 8 proteins are retaining enzymes based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. The non-catalytic N-terminal portion of the human UTG1 (HUGT1) has been shown to monitor the protein folding status and activate its glucosyltransferase activity.
132996	Glyco_transf_8	9.92e-60	1391	1631	1	243	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
408199	Thioredoxin_12	1.46e-38	38	242	1	182	Thioredoxin-like domain. This is one of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).
399437	UDP-g_GGTase	1.32e-25	1206	1313	2	109	UDP-glucose:Glycoprotein Glucosyltransferase. UDP-g_GGTase is an important, central component of the QC system in the ER for checking that glycoproteins are folded correctly. This QC prevents incorrectly folded glycoproteins from leaving the ER.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ20865.1|GT24	0.0	1	1672	1	1666
CCA14500.1|GT24	0.0	26	1666	36	1665
AIG56125.1|GT24	0.0	8	1666	8	1505
AIG55512.1|GT24	0.0	15	1669	13	1518
BBN16825.1|GT24	2.32e-201	26	1664	39	1599

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NV4_A	3.47e-147	204	1661	164	1446	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5MU1_A	6.55e-147	204	1661	164	1446	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5MZO_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TRF_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TRT_A	1.24e-146	204	1661	164	1446	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS2_A	4.93e-142	985	1661	550	1212	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_C Chain C, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_D Chain D, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS8_A	2.13e-120	204	1598	157	1382	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS8_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0WL80|UGGG_ARATH	2.16e-190	26	1660	31	1566	UDP-glucose:glycoprotein glucosyltransferase OS=Arabidopsis thaliana OX=3702 GN=UGGT PE=1 SV=1
sp|Q6P5E4|UGGG1_MOUSE	1.09e-185	26	1660	45	1521	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Mus musculus OX=10090 GN=Uggt1 PE=1 SV=4
sp|Q9NYU2|UGGG1_HUMAN	2.29e-185	26	1669	45	1530	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1 PE=1 SV=3
sp|Q9NYU1|UGGG2_HUMAN	1.35e-182	22	1665	29	1501	UDP-glucose:glycoprotein glucosyltransferase 2 OS=Homo sapiens OX=9606 GN=UGGT2 PE=1 SV=4
sp|Q9JLA3|UGGG1_RAT	1.46e-182	26	1660	45	1521	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Uggt1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000394	0.999583	CS pos: 25-26. Pr: 0.9260

TMHMM  Annotations     

There is no transmembrane helices in PHYCI_19262T0-p1.