CAZyme Information: PHYCI_1635T0-p1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: PHYCI_1635T0-p1
• CAZy Family: AA3
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
796	PcinCBS144-22_SC0005|CGC3	86563.80	4.2154

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiCBS144-22	26201	1048749	70	26131

• Gene Location: location=PcinCBS144-22_SC0005:700673-703063(+)

Full Sequence      

MTTNWLLVAIHAALLHSALASSSSSGSDSLDAQAQTIVNDFSTDQVIGQMCQLDISMVLN
DDNSVNETLVRRYAKLGVGSYLNSPFAGWNATGWRNAIKEIQTYHMDENGGHPMVYGLDS
VHGAQYVDQAVMFPQQINAGASFNPELARAMGYITARDTAAAGITWVLGPILDISYNPLW
TRTYETFGEDPYLTSVLGAAYIRGVQNNSQSGACMKHFIGYSQTATGVDRESTTISDYDL
LNHHVPSFKAGIEHGAMSTMENYVSVNGVPVVSSTKILKNLLRNDLDFSGVVVTDWGEVN
NLQSWHRVVSTQQDAVELVIANTSLDMSMVPYSTDFIDQAKYVLSSNSDYEDRLRSSAKR
IIKMKLQMGLYDTPVPGEDNVDLVGNDDDLEEALNLARESIVLLKNDDNLLPLRNGTSLF
LTGFSVDDIGYQCGGWSIYWQGTSGNDYFAHGTSVRQGIEDLVGTDSVTYFNGLNVDGTY
SDEDLSTATGYASSADVVVVAIGEAPYAEKWGDIDELTLPSGQLEYVQALANTGTKVVLI
LFEGRPRLLGSLPDLVSAVVWGGLPCEQGGQAMAEILFGEVNPSGRLPITYPKYSGHIMI
PYRHRVDTQCTYGDCEMQWDFGAGLSYTSFWYSDLTLSTKKITSQSNTLTASVAVTNNGT
MAGKETVMLFMIQPYRSISVPEVKMLRKFEKIELEAGASTTVMFTLTADDWSVYKPNIGS
GFNQVAENGEFVVAIHPDTDCDVYNDAGITNNLCATFTLAATSATVGDSTSSSASMAEFA
WWAAALSLVVGFTFCE

Enzyme Prediction     

EC	3.2.1.21:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	109	321	2.2e-62	0.9398148148148148

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	4.56e-105	113	739	105	754	beta-glucosidase BglX.
224389	BglX	4.73e-65	42	465	2	389	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
178629	PLN03080	3.29e-56	127	706	108	742	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	1.62e-50	42	362	1	314	Glycosyl hydrolase family 3 N terminal domain.
396478	Glyco_hydro_3_C	9.72e-48	401	627	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29009.1|GH3	2.48e-310	28	759	24	762
CCA27737.1|GH3	4.52e-287	33	759	67	808
UIZ29613.1|GH3	5.71e-284	5	764	50	824
UIZ27116.1|GH3	1.85e-277	50	759	1	724
UIZ29432.1|GH3	5.57e-270	5	764	5	768

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JP0_A	2.81e-130	44	710	27	718	Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus],5JP0_B Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus]
5M6G_A	7.74e-76	94	591	104	587	Crystal structure Glucan 1,4-beta-glucosidase from Saccharopolyspora erythraea [Saccharopolyspora erythraea D]
5Z9S_A	2.53e-73	37	735	31	771	Functional and Structural Characterization of a beta-Glucosidase Involved in Saponin Metabolism from Intestinal Bacteria [Bifidobacterium longum],5Z9S_B Functional and Structural Characterization of a beta-Glucosidase Involved in Saponin Metabolism from Intestinal Bacteria [Bifidobacterium longum]
5TF0_A	3.07e-73	44	735	23	736	Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]
4ZOA_A	4.09e-73	101	744	72	715	Crystal Structure of beta-glucosidase from Listeria innocua in complex with isofagomine [Listeria innocua Clip11262],4ZOA_B Crystal Structure of beta-glucosidase from Listeria innocua in complex with isofagomine [Listeria innocua Clip11262],4ZOB_A Crystal Structure of beta-glucosidase from Listeria innocua in complex with gluconolactone [Listeria innocua Clip11262],4ZOB_B Crystal Structure of beta-glucosidase from Listeria innocua in complex with gluconolactone [Listeria innocua Clip11262],4ZOD_A Crystal Structure of beta-glucosidase from Listeria innocua in complex with glucose [Listeria innocua Clip11262],4ZOD_B Crystal Structure of beta-glucosidase from Listeria innocua in complex with glucose [Listeria innocua Clip11262],4ZOE_A Crystal Structure of beta-glucosidase from Listeria innocua [Listeria innocua Clip11262],4ZOE_B Crystal Structure of beta-glucosidase from Listeria innocua [Listeria innocua Clip11262]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q23892|GLUA_DICDI	3.77e-150	31	735	77	811	Lysosomal beta glucosidase OS=Dictyostelium discoideum OX=44689 GN=gluA PE=1 SV=2
sp|A7LXU3|BGH3B_BACO1	2.10e-129	44	710	49	740	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1
sp|T2KMH0|PLH24_FORAG	8.25e-80	114	750	68	721	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
sp|Q56078|BGLX_SALTY	9.34e-78	31	739	35	754	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
sp|P33363|BGLX_ECOLI	4.73e-77	31	739	35	754	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000203	0.999758	CS pos: 20-21. Pr: 0.9821

TMHMM  Annotations     

There is no transmembrane helices in PHYCI_1635T0-p1.