CAZyme Information: PHYCI_16066T0-p1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: PHYCI_16066T0-p1
• CAZy Family: AA2|AA2
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
348	PcinCBS144-22_SC0164|CGC1	37927.34	5.3173

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiCBS144-22	26201	1048749	70	26131

• Gene Location: location=PcinCBS144-22_SC0164:14847-15893(+)

Full Sequence      

MHFFTLPLVALAGLAVGVGAQVPNACNGPNARTVPPPGAIVIDITGTHNNSYQTVTEGMA
YLPNTTEEHTIFLFPGVYQEQVLIPKLAGPLVLQGYTCDTMSYSENTVTITHTMAQRDFA
PEIKNSRNDLVSTLRLKSSSGVKIYNTNAANPTGKIDQLGQAMAVYVDAPNYGFYGCNFT
GWQDTLCAHKGREFYARSYISGAVDFVFGMQAKAWFESCDFEPVGQGWITANGNYNSSNL
SEYAFNRARVFGSSGNGSTYFGRPWYPYARVVWLNSELSDVASPAGWSVWDSATSTANVT
FKEFNNRGPGTATGQRVSFSGQLNASVAITELLGNGFESEWWVDTKFL

Enzyme Prediction     

EC	3.1.1.11:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	49	326	1.7e-63	0.9236111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178372	PLN02773	2.02e-41	52	323	17	282	pectinesterase
178113	PLN02497	1.23e-37	162	344	142	327	probable pectinesterase
395871	Pectinesterase	6.16e-37	52	321	12	276	Pectinesterase.
178051	PLN02432	1.30e-35	39	328	10	277	putative pectinesterase
178606	PLN03043	1.00e-33	39	329	224	512	Probable pectinesterase/pectinesterase inhibitor; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACO54874.1|CE8	4.17e-220	1	348	1	348
ACO54872.1|CE8|3.1.1.11	6.90e-189	1	348	1	348
ACO54870.1|CE8	9.47e-182	1	348	1	347
ACO54875.1|CE8	3.01e-166	10	348	6	346
ABQ63096.1|CE8	8.65e-161	1	348	1	344

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1C_A	2.54e-55	31	347	2	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
5C1E_A	3.58e-55	31	347	2	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
1GQ8_A	8.14e-28	31	321	2	283	Pectin methylesterase from Carrot [Daucus carota]
1XG2_A	1.06e-26	52	321	15	279	Chain A, Pectinesterase 1 [Solanum lycopersicum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12535|PME_ASPAC	2.16e-71	31	347	19	330	Pectinesterase OS=Aspergillus aculeatus OX=5053 GN=pme1 PE=2 SV=1
sp|P17872|PME_ASPNG	8.57e-71	31	348	19	330	Pectinesterase OS=Aspergillus niger OX=5061 GN=pme1 PE=1 SV=1
sp|Q4WBT5|PMEA_ASPFU	2.12e-63	6	347	3	324	Probable pectinesterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pmeA PE=3 SV=1
sp|B0Y9F9|PMEA_ASPFC	2.12e-63	6	347	3	324	Probable pectinesterase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pmeA PE=3 SV=1
sp|A1DBT4|PMEA_NEOFI	1.46e-60	6	347	3	324	Probable pectinesterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000185	0.999799	CS pos: 20-21. Pr: 0.9467

TMHMM  Annotations     

There is no transmembrane helices in PHYCI_16066T0-p1.