CAZyme Information: PHYCI_1553T0-p1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: PHYCI_1553T0-p1
• CAZy Family: AA2
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
493		53737.14	4.2956

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiCBS144-22	26201	1048749	70	26131

• Gene Location: location=PcinCBS144-22_SC0005:438285-439765(+)

Full Sequence      

MLKTWVGALCCATLGLTAARSIDEFDDQARAIVDNLTTEQVLGQLAQVGVSALLNDDYSL
NETLVRDYAKLKIGSYLTTPFTSGANDITGEVGWDVSQWRDIITRIQEIAMEENDGIPMV
YGIDTVHGAGFVLNSTVFGAQLNGAASFNPDLVYEMGRIGAQDTRAAGIPWVFGPILEIA
SNPLWPRTYETFGEDPHLVSVMADAVVRGLQSDNQTAACMKHFVAYSKTPTGHDQDQVQI
SDFDLLNYFVRPFKAAIDAGALTTMENYISINGVPVIGNHRILDVLLREDLAYDGMAVSD
FGEIGSMNSFHRVARDANEAVRFSYTHTGIDMSMGFDSTYLNGTKLLIEESPEYLDRLKD
SARRIIKLKLQLGLYDNPVPGADDVALVRSDDDVQKSLDMARESIVLLQNNDSTLPISTS
ASVFLTGHSAHNIGNQCGGWSVSWHGFTGNDNFPNGISVKEGMETIAGSDKITYFNGLDS
DGNYSEANMTTAK

Enzyme Prediction     

EC	3.2.1.21:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	112	334	3.6e-59	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	2.28e-69	36	442	1	373	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
185053	PRK15098	9.39e-62	100	493	86	468	beta-glucosidase BglX.
395747	Glyco_hydro_3	1.06e-48	37	368	1	316	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	2.01e-23	129	441	105	441	Probable beta-xylosidase; Provisional
396478	Glyco_hydro_3_C	2.42e-05	405	470	1	59	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29009.1|GH3	5.48e-181	1	492	1	493
UIZ29613.1|GH3	1.06e-161	1	490	46	546
CCA27737.1|GH3	1.09e-160	16	492	55	533
UIZ27116.1|GH3	4.07e-160	45	493	1	451
UIZ29432.1|GH3	1.51e-156	1	490	1	490

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JP0_A	3.35e-71	30	478	18	470	Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus],5JP0_B Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus]
5M6G_A	3.52e-58	99	487	104	494	Crystal structure Glucan 1,4-beta-glucosidase from Saccharopolyspora erythraea [Saccharopolyspora erythraea D]
6JG7_A	2.97e-53	26	475	17	467	Crystal structure of barley exohydrolaseI W286F in complex with methyl 2-thio-beta-sophoroside [Hordeum vulgare subsp. vulgare],6JGA_A Crystal structure of barley exohydrolaseI W286F in complex with 4'-nitrophenyl thiolaminaribioside [Hordeum vulgare subsp. vulgare],6JGB_A Crystal structure of barley exohydrolaseI W286F mutant in complex with methyl 6-thio-beta-gentiobioside [Hordeum vulgare subsp. vulgare]
6JGC_A	7.87e-53	26	475	17	467	Crystal structure of barley exohydrolaseI W286Y mutant in complex with glucose. [Hordeum vulgare subsp. vulgare],6JGD_A Crystal structure of barley exohydrolaseI W286Y mutant in complex with methyl 6-thio-beta-gentiobioside [Hordeum vulgare subsp. vulgare]
1LQ2_A	1.35e-52	26	475	13	463	Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme Exo1 in complex with gluco-phenylimidazole [Hordeum vulgare],1X38_A crystal structure of barley beta-D-glucan glucohydrolase isoenzyme exo1 in complex with gluco-phenylimidazole [Hordeum vulgare],1X39_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme exo1 in complex with gluco-phenylimidazole [Hordeum vulgare]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q23892|GLUA_DICDI	1.33e-78	33	466	80	533	Lysosomal beta glucosidase OS=Dictyostelium discoideum OX=44689 GN=gluA PE=1 SV=2
sp|A7LXU3|BGH3B_BACO1	2.14e-70	30	478	40	492	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1
sp|Q56078|BGLX_SALTY	1.06e-45	95	479	88	463	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
sp|P33363|BGLX_ECOLI	3.22e-44	100	479	86	463	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
sp|T2KMH0|PLH24_FORAG	2.60e-40	71	481	9	448	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000361	0.999618	CS pos: 19-20. Pr: 0.9663

TMHMM  Annotations     

There is no transmembrane helices in PHYCI_1553T0-p1.