CAZyme Information: PHYCI_11364T0-p1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: PHYCI_11364T0-p1
• CAZy Family: AA17
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
551		61240.25	6.4243

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiCBS144-22	26201	1048749	70	26131

• Gene Location: location=PcinCBS144-22_SC0084:9967-11622(-)

Full Sequence      

MPLLLLALAALLLPSHVAAEGMNSVMGIINTKRSVKLDPSVQHIPLDPAQSNLRPPPAQI
PASFDVFVGLSVFRDGYRCGKTIFTGLKRAKYPERLFFGVVDQVNDGDDRCLDEFCKMAE
AEWPDKGPCPYKDHIRVDVHSASESRGPTLARHQQQKLIRQEEFCLQLDGHSIFTNLWDE
NLLAEWKRINNEMAVISTYLHHIHDFVKENGDNALSASLPHLCSTMRGSNGLVRTVGASM
ISGSKFPQLEALWGAGLSFNKCHAERRVPVDSHTLWMFDGEEFLRASRLWTSGYDMYSPS
VLGSVIYHNYSKVPARFEHITVDRQVKKRESEMAINRFNHIVGKPIKGLVDTYELDKYGL
GSVRSFESYLKFSGVTFKEGVNDTESCEQLHWVPYENATEVEALVGNGWKLKEKSAVVAE
PTPKQQVAQEVEQDAEAQKATGTKEGTTQPPKERGVVDDDPNAEVARHAADAHAENGADI
GEDEQLEAAKARLRQEVVGNRAAKGPSTAPIWFFLFVVVAALFVTLSKDSVSRSIRLTFC
ASAPHTHSSNE

Enzyme Prediction     

No EC number prediction in PHYCI_11364T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT60	65	378	1.2e-58	0.996969696969697

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
371506	GlcNAc	1.14e-39	65	377	1	349	Glycosyltransferase (GlcNAc). GlcNAc is an enzyme that carries out the first glycosylation step of hydroxylated Skp1, a ubiquitous eukaryotic protein, in the cytoplasm.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ22573.1|GT60	1.13e-261	3	551	9	503
QVE55543.1|GT60	7.65e-206	4	538	7	481
UIZ25301.1|GT60	6.26e-198	20	411	4	397
UIZ25379.1|GT60	7.01e-174	33	540	39	513
CCA18910.1|GT60	8.25e-37	70	395	91	412

PDB Hits     

PHYCI_11364T0-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8T1C6|GNT1_DICDI	6.48e-18	66	312	6	251	[Skp1-protein]-hydroxyproline N-acetylglucosaminyltransferase OS=Dictyostelium discoideum OX=44689 GN=gnt1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000226	0.999751	CS pos: 19-20. Pr: 0.9775

TMHMM  Annotations     

Start	End
509	526