CAZyme Information: PHYCI_1135T0-p1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: PHYCI_1135T0-p1
• CAZy Family: AA17
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
360		40355.97	7.0822

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiCBS144-22	26201	1048749	70	26131

• Gene Location: location=PcinCBS144-22_SC0004:142992-144239(+)

Full Sequence      

MINAAFALLLGACSLVVAVADPRVMIETTYTATEGLNDLAKTAWKDKGGKYMGTATDLKQ
LSDPYYLQVLNDTHDFGMITPANAMKWDATEPKQGVFTFDYADKIVAYANKTGSQIRCHT
LVWHQQVPDWVKVLEKAELLKAMSTHITKLMTHFGNSCTAWDVVNEAMNEDGSYRESFWY
KKTGKDYIETAYKTANAVKAELGLTARLYYNDYNINVVNNKSDAVLDMVTKLRSRKIWVE
GVGFQSHYSNNDTVAGAKIFDNLRRFTVKHMDVAITELDVKTSTVNPTVSEQREQVGIYT
NVVSACKKTMRCVGVTVWDFVDTYSWINSSAPLLFYQPDGPSTPLVRKATYDAVTAGWIL

Enzyme Prediction     

EC	3.2.1.8:31

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	41	337	1.6e-87	0.9438943894389439

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395262	Glyco_hydro_10	1.54e-107	36	354	1	308	Glycosyl hydrolase family 10.
214750	Glyco_10	2.47e-90	85	354	1	263	Glycosyl hydrolase family 10.
226217	XynA	3.71e-72	53	338	39	330	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOV63056.1|GH10	1.41e-226	3	360	2	359
AOV63057.1|GH10	9.25e-215	3	359	2	354
UIZ28775.1|GH10	1.62e-178	1	360	1	356
UIZ24493.1|GH10	8.83e-164	1	360	1	354
AOV63055.1|GH10	8.11e-140	25	358	21	350

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XZO_A	4.20e-85	35	352	2	327	Chain A, Beta-xylanase [Bispora sp. MEY-1],5XZO_B Chain B, Beta-xylanase [Bispora sp. MEY-1],5XZU_A Chain A, Beta-xylanase [Bispora sp. MEY-1],5XZU_B Chain B, Beta-xylanase [Bispora sp. MEY-1]
6JDT_A	2.31e-83	35	357	2	316	Crystal structure of GH10 family xylanase XynAF1 from Aspergillus fumigatus Z5 [Aspergillus fumigatus Z5],6JDT_B Crystal structure of GH10 family xylanase XynAF1 from Aspergillus fumigatus Z5 [Aspergillus fumigatus Z5],6JDY_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 120 minutes [Aspergillus fumigatus Z5],6JDY_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 120 minutes [Aspergillus fumigatus Z5],6JDZ_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 20 minutes [Aspergillus fumigatus Z5],6JDZ_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 20 minutes [Aspergillus fumigatus Z5],6JE0_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 30 minutes [Aspergillus fumigatus Z5],6JE0_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 30 minutes [Aspergillus fumigatus Z5],6JE1_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 40 minutes [Aspergillus fumigatus Z5],6JE1_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 40 minutes [Aspergillus fumigatus Z5],6JE2_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 80 minutes [Aspergillus fumigatus Z5],6JE2_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 80 minutes [Aspergillus fumigatus Z5]
3WUF_A	2.24e-76	49	356	13	310	The mutant crystal structure of b-1,4-Xylanase (XynAS9_V43P/G44E) from Streptomyces sp. 9 [Streptomyces sp.],3WUG_A The mutant crystal structure of b-1,4-Xylanase (XynAS9_V43P/G44E) with xylobiose from Streptomyces sp. 9 [Streptomyces sp.]
3WUB_A	3.57e-75	49	356	13	310	The wild type crystal structure of b-1,4-Xylanase (XynAS9) from Streptomyces sp. 9 [Streptomyces sp.],3WUE_A The wild type crystal structure of b-1,4-Xylanase (XynAS9) with xylobiose from Streptomyces sp. 9 [Streptomyces sp.]
6Q8M_A	4.19e-73	47	357	32	338	GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8M_B GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8N_A GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872],6Q8N_B GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9HEZ1|XYNA_PHACH	6.60e-75	31	358	89	406	Endo-1,4-beta-xylanase A OS=Phanerodontia chrysosporium OX=2822231 GN=xynA PE=1 SV=1
sp|B4XVN1|XYNA_STRSQ	1.29e-72	49	356	51	348	Endo-1,4-beta-xylanase A OS=Streptomyces sp. OX=1931 GN=xynAS9 PE=1 SV=1
sp|O60206|XLNA_AGABI	2.99e-72	36	358	19	331	Endo-1,4-beta-xylanase OS=Agaricus bisporus OX=5341 GN=xlnA PE=2 SV=1
sp|G4MLU0|XYN5_MAGO7	5.88e-72	31	332	33	328	Endo-1,4-beta-xylanase 5 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=XYL5 PE=3 SV=1
sp|Q8J1Y4|XYN5_MAGGR	5.88e-72	31	332	33	328	Endo-1,4-beta-xylanase 5 OS=Magnaporthe grisea OX=148305 GN=XYL5 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000242	0.999724	CS pos: 20-21. Pr: 0.9348

TMHMM  Annotations     

There is no transmembrane helices in PHYCI_1135T0-p1.