CAZyme Information: PHYCI_113206T0-p1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: PHYCI_113206T0-p1
• CAZy Family: AA17
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
413	PcinCBS144-22_SC0013|CGC1	42347.78	4.1683

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiCBS144-22	26201	1048749	70	26131

• Gene Location: location=PcinCBS144-22_SC0013:247641-248882(-)

Full Sequence      

MKVLFAAALTAAAVSVTSAAEFCDQWGQVKSGNYIIYNNLWGSSAASSGGKQCTALDSAS
GDSVAWHTTWTWQGGDKSVKSFANAALQFDPVPLSQVKSIPSTMAYSVKSSGKAVTDVSY
DLFTSSSATGEKEFEIMIWLAALGGAGAISSTGKPIASTTIAGTQWSVYKGPNGSMMVYS
FVASKQVENFDGDLKEFLDYLVKEQSFKDSQYLIKVECGTEPFVGTDVTMTVSKYSASVI
TGSGGSPTPAQSGDSSSAYEQTTTAPSTGSSAEQTTPAPADPSTGSSTEQTTTAPAASDA
GSSKQSPSTPSTGSSTEQTTDAPAASNTGSSEETPSTGSNYETPATSDAGSSAETPSTGS
SYETPSTGDSSTSQQEPTTPGTPSTSSSSEETPSTPSTPETNPKCVLRRVRRD

Enzyme Prediction     

EC	3.2.1.4:15	3.2.1.151:9

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH12	91	239	1.4e-41	0.9871794871794872

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396303	Glyco_hydro_12	4.03e-43	32	239	1	206	Glycosyl hydrolase family 12.
235746	PRK06215	4.20e-18	23	182	41	180	hypothetical protein; Provisional
236090	PRK07764	4.85e-04	242	365	389	512	DNA polymerase III subunits gamma and tau; Validated
183558	PRK12495	0.003	264	375	72	180	hypothetical protein; Provisional
215130	PLN02217	0.003	235	351	557	664	probable pectinesterase/pectinesterase inhibitor

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABB22031.1|GH12	2.79e-157	1	266	1	265
ABB22039.1|GH12	2.34e-117	1	253	1	252
ABB22038.1|GH12	6.23e-97	1	242	1	242
ABB22030.1|GH12	9.25e-96	1	239	1	238
ABB22036.1|GH12	2.60e-88	1	239	1	238

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4NPR_A	7.89e-81	16	239	21	242	Crystal Structure of the Family 12 Xyloglucanase from Aspergillus niveus [Aspergillus niveus],4NPR_B Crystal Structure of the Family 12 Xyloglucanase from Aspergillus niveus [Aspergillus niveus]
3VL8_A	2.02e-77	15	239	7	228	Crystal structure of XEG [Aspergillus aculeatus],3VL9_A Crystal structure of xeg-xyloglucan [Aspergillus aculeatus],3VL9_B Crystal structure of xeg-xyloglucan [Aspergillus aculeatus]
3VLB_B	3.21e-77	20	239	5	221	Crystal structure of xeg-edgp [Aspergillus aculeatus],3VLB_D Crystal structure of xeg-edgp [Aspergillus aculeatus]
5GM3_A	5.57e-55	20	239	1	218	Crystal structure of FI-CMCase from Aspergillus aculeatus F-50 [Aspergillus aculeatus],5GM3_B Crystal structure of FI-CMCase from Aspergillus aculeatus F-50 [Aspergillus aculeatus]
5GM4_A	4.33e-54	20	239	1	218	Crystal structure of FI-CMCase from Aspergillus aculeatus F-50 in complex with cellotetrose [Aspergillus aculeatus],5GM4_B Crystal structure of FI-CMCase from Aspergillus aculeatus F-50 in complex with cellotetrose [Aspergillus aculeatus],5GM4_C Crystal structure of FI-CMCase from Aspergillus aculeatus F-50 in complex with cellotetrose [Aspergillus aculeatus],5GM4_D Crystal structure of FI-CMCase from Aspergillus aculeatus F-50 in complex with cellotetrose [Aspergillus aculeatus],5GM4_E Crystal structure of FI-CMCase from Aspergillus aculeatus F-50 in complex with cellotetrose [Aspergillus aculeatus],5GM4_F Crystal structure of FI-CMCase from Aspergillus aculeatus F-50 in complex with cellotetrose [Aspergillus aculeatus],5GM4_G Crystal structure of FI-CMCase from Aspergillus aculeatus F-50 in complex with cellotetrose [Aspergillus aculeatus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BG78|XGEA_EMENI	5.25e-88	1	239	1	238	Xyloglucan-specific endo-beta-1,4-glucanase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xgeA PE=1 SV=1
sp|G4ZHR2|XEG1_PHYSP	1.81e-86	1	239	1	240	Xyloglucan-specific endo-beta-1,4-glucanase 1 OS=Phytophthora sojae (strain P6497) OX=1094619 GN=XEG1 PE=1 SV=1
sp|Q0CRC9|XGEA_ASPTN	4.87e-86	15	239	26	249	Probable xyloglucan-specific endo-beta-1,4-glucanase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=xgeA PE=3 SV=2
sp|W2PEP3|XEG1_PHYPN	1.02e-85	1	239	1	240	Xyloglucan-specific endo-beta-1,4-glucanase 1 OS=Phytophthora parasitica (strain INRA-310) OX=761204 GN=XEG1 PE=1 SV=1
sp|A1CRJ0|XGEA_ASPCL	4.10e-85	1	239	1	240	Probable xyloglucan-specific endo-beta-1,4-glucanase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=xgeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000225	0.999722	CS pos: 19-20. Pr: 0.9705

TMHMM  Annotations     

There is no transmembrane helices in PHYCI_113206T0-p1.