CAZyme Information: PHYCI_102656T0-p1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: PHYCI_102656T0-p1
• CAZy Family: AA1
• CAZyme Description: Glucosyltransferase - Alg6p

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
525		59719.27	8.2613

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiCBS144-22	26201	1048749	70	26131

Full Sequence      

MTEASLLQRGLQFLEENDEKRAGAWLVWLLVVLVRWLVGLHSYSGEHTAPMFGDYEAQRH
WMELTINLPVSDWYFNTTSNDLLYWGLDYPPLTAYVSYLFGRAAEITEPAMVELTSSRGY
ETATSKVFMRTSVLLCDVALFIPAIYFVARAIYGGEQWTRRMAFLLLVLLQPAVLLIDHG
HFQYNNVCLGFTALGVALILQGHEFLGSISYCLALNFKQMALYYAPAFGVFLLARCIYRK
MCILHLVKVAVAVIATFTVMWFPFCMYTSAGETCLSTMAQVVHRIFPFGRGLFEDKVANF
WCIADFVLKIRRHVTPTLQMRLCTMMTFVGFSPSVFDLLRRKPTNLRFVLSLAICSLSFF
LFSFQVHEKTILLPLLPISFLFAHNALLSGWFSVLSTFSMYFLLKKDGLVLPYIVLQLAY
VSVGVAPFLTSRTAMQLHVQQTKIAPGYQRDGSAHPLFRAYVMLSLVGILAIHAAQVWIT
PPAQYPHIHDYVFAAYSCGHFLLALVYLTYWQWTAETGDNKTKTE

Enzyme Prediction     

EC	2.4.1.267:14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT57	32	508	6e-139	0.9937629937629938

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397324	Alg6_Alg8	5.78e-163	50	503	10	471	ALG6, ALG8 glycosyltransferase family. N-linked (asparagine-linked) glycosylation of proteins is mediated by a highly conserved pathway in eukaryotes, in which a lipid (dolichol phosphate)-linked oligosaccharide is assembled at the endoplasmic reticulum membrane prior to the transfer of the oligosaccharide moiety to the target asparagine residues. This oligosaccharide is composed of Glc(3)Man(9)GlcNAc(2). The addition of the three glucose residues is the final series of steps in the synthesis of the oligosaccharide precursor. Alg6 transfers the first glucose residue, and Alg8 transfers the second one. In the human alg6 gene, a C->T transition, which causes Ala333 to be replaced with Val, has been identified as the cause of a congenital disorder of glycosylation, designated as type Ic OMIM:603147.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ20779.1|GT57	UIZ20779.1|GT57	8.09e-274	3	525	6	589
CCA15270.1|GT57	CCA15270.1|GT57	5.48e-191	3	521	5	527
CAG31431.1|GT57	CAG31431.1|GT57	2.05e-122	29	523	12	505
CAD60191.1|GT57	CAD60191.1|GT57	2.05e-122	29	523	12	505
AAH77552.1|GT57	AAH77552.1|GT57	1.00e-116	29	521	12	505

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SNH_X	6SNH_X	3.82e-96	25	486	58	525	Cryo-EM structure of yeast ALG6 in complex with 6AG9 Fab and Dol25-P-Glc [Saccharomyces cerevisiae],6SNI_X Cryo-EM structure of nanodisc reconstituted yeast ALG6 in complex with 6AG9 Fab [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q802T2|ALG6_CHICK	sp|Q802T2|ALG6_CHICK	3.65e-123	29	523	12	505	Dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Gallus gallus OX=9031 GN=ALG6 PE=2 SV=1
sp|Q54QG6|ALG6_DICDI	sp|Q54QG6|ALG6_DICDI	1.02e-122	26	507	20	502	Probable dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Dictyostelium discoideum OX=44689 GN=alg6 PE=3 SV=1
sp|Q9Y672|ALG6_HUMAN	sp|Q9Y672|ALG6_HUMAN	9.09e-112	25	523	4	505	Dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Homo sapiens OX=9606 GN=ALG6 PE=1 SV=2
sp|Q3TAE8|ALG6_MOUSE	sp|Q3TAE8|ALG6_MOUSE	2.02e-110	29	525	12	507	Dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Mus musculus OX=10090 GN=Alg6 PE=2 SV=1
sp|Q5NVS8|ALG6_PONAB	sp|Q5NVS8|ALG6_PONAB	2.02e-110	25	523	4	505	Dolichyl pyrophosphate Man9GlcNAc2 alpha-1,3-glucosyltransferase OS=Pongo abelii OX=9601 GN=ALG6 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000027	0.000006

TMHMM  Annotations     

Start	End
21	43
82	101
132	154
158	177
184	206
221	238
243	265
317	339
346	365
380	402
409	431
457	479
492	514