CAZyme Information: PHYCI_10238T0-p1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: PHYCI_10238T0-p1
• CAZy Family: AA1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
328		36571.23	6.1644

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiCBS144-22	26201	1048749	70	26131

• Gene Location: location=PcinCBS144-22_SC0070:196443-197429(+)

Full Sequence      

MDSENNQKWTFEESSGQLKHAVHQSFCLDQDAGQNNKLQLYGCSPHNPNQQWGLMDPNDI
SDNWAFSDESVRFYTMESSKPFAQLVRSGDNVAIGFGGTNVGGSQWFYDANTHLVKAKDS
NMCLDAYQPWDGGIVHVYACNTNEVNQRWNVDSTTNQLKHLTHTGFCLDADLSANNGAGK
LQLWGCHLNNNQVWRMIPASATAVTVHSSSANDSYLQPTLQDTVVGASSTGNSQQHWFWD
ANSNRLISKINAQCLDAYEPWQGGRVHTYSCVATEGNQKWNYDATNQVVKHVKHIGFCLA
FDNLSNKLLQLKSCNAGDNTQRIRIEVA

Enzyme Prediction     

EC	-	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM13	100	210	1.1e-16	0.5957446808510638

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395527	Ricin_B_lectin	2.62e-14	102	194	35	126	Ricin-type beta-trefoil lectin domain.
395527	Ricin_B_lectin	5.50e-12	115	280	5	126	Ricin-type beta-trefoil lectin domain.
238092	RICIN	1.14e-11	87	196	18	124	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
395527	Ricin_B_lectin	2.27e-10	163	322	9	125	Ricin-type beta-trefoil lectin domain.
238092	RICIN	1.96e-09	119	239	8	124	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG55540.1|CBM13	5.58e-39	105	324	377	592
AIG55751.1|CBM13|GH3	9.32e-34	105	315	792	1006
CCD28161.1|CBM13|GH17	2.85e-30	106	200	133	226
AIG56285.1|CBM13|GH3	6.23e-30	105	315	811	1026
AIG56282.1|CBM13	1.08e-29	105	299	373	552

PDB Hits     

PHYCI_10238T0-p1 has no PDB hit.

Swiss-Prot Hits     

PHYCI_10238T0-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000082	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PHYCI_10238T0-p1.