CAZyme Information: PHYCI_10237T0-p1

Basic Information

• Species: Phytophthora cinnamomi
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora cinnamomi
• CAZyme ID: PHYCI_10237T0-p1
• CAZy Family: AA1
• CAZyme Description: Predicted polypeptide N-acetylgalactosaminyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
252		28307.53	7.7176

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PcinnamomiCBS144-22	26201	1048749	70	26131

• Gene Location: location=PcinCBS144-22_SC0070:193669-194427(+)

Full Sequence      

FSFWEQADVNEATAITLDRLKNLRVLAAKKNKKVVISETGWSSGGSDPAAGVASPANQAK
FFSDFFQMARSHAFDYYWYVAFDSKWRVTNGGKEVEADFGIFQEDDTMKSNFRGLTIGTK
NPSALRNAGTKLLLSENNGNVYMSSKSADWLVQEQQVWFFDSATQQVRSKSSDRCLDAYQ
PWNAGIVHVYRCMDNEVNQKWTFEASTGKLKHAKHQGFCLDTDPAQGNKLQLYGCSPNNP
NQQWNVINPASI

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM13	123	248	6e-18	0.6808510638297872

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395527	Ricin_B_lectin	1.49e-17	124	244	4	126	Ricin-type beta-trefoil lectin domain.
238092	RICIN	2.87e-12	156	245	36	123	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
227625	Scw11	4.86e-11	1	106	201	305	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
238092	RICIN	5.33e-11	171	248	8	84	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
214672	RICIN	1.80e-10	169	248	3	78	Ricin-type beta-trefoil. Carbohydrate-binding domain formed from presumed gene triplication.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBC18032.1|CBM13|GH17	5.15e-138	1	252	192	443
QBC18038.1|CBM13|GH17	5.15e-138	1	252	192	443
QBC18040.1|CBM13|GH17	5.15e-138	1	252	192	443
QBC18039.1|CBM13|GH17	5.15e-138	1	252	192	443
QBC18034.1|CBM13|GH17	5.15e-138	1	252	192	443

PDB Hits     

PHYCI_10237T0-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B0Y429|BTGC_ASPFC	1.48e-06	3	113	554	678	Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=btgC PE=3 SV=1
sp|Q4WUK5|BTGC_ASPFU	1.48e-06	3	113	554	678	Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=btgC PE=3 SV=1
sp|Q0CI96|BTGC_ASPTN	6.29e-06	3	113	521	645	Probable glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=btgC PE=3 SV=2
sp|B8NTP7|BTGC_ASPFN	8.52e-06	1	94	565	654	Probable glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=btgC PE=3 SV=2
sp|Q2U492|BTGC_ASPOR	8.52e-06	1	94	565	654	Probable glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=btgC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000057	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PHYCI_10237T0-p1.