CAZyme Information: PHYBL_99542T0-p1

Basic Information

• Species: Phycomyces blakesleeanus
• Lineage: Mucoromycota; Mucoromycetes; ; Phycomycetaceae; Phycomyces; Phycomyces blakesleeanus
• CAZyme ID: PHYBL_99542T0-p1
• CAZy Family: GT76
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
295	PblaNRRL1555-_SC40|CGC1	34078.86	4.8808

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PblakesleeanusNRRL1555	16528	763407	0	16528

• Gene Location: location=PblaNRRL1555-_SC40:236077-237046(-)

Full Sequence      

DPRLVRSFWGVDYTPHGTQLQFGCGVTQEEVIQDLRLLYQITPRIRLYGMDCNQADYVLN
GMRILNINMGVILTIWVDSNQTTYQRQYDTFWRVLETYGGDNIIGVSIGNEALFRKEVSV
STLVASIRDVKKKMIAMGYPKIPVYTSDIRELPKLMPEQDAVLDNVHPFFAGTLPQDAAN
WTWHYFYGVDQYPTIKLAEKLNQTQTKPAMISEIGWPTFPEDGSIQAAIPSVENQKILLD
TFICQANRRGVPYFWFEFKDEPWKQDMFNETRESFWGIFDKDNNLKVSSLPNCTL

Enzyme Prediction     

No EC number prediction in PHYBL_99542T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	28	286	8.2e-27	0.9356913183279743

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	3.12e-38	29	282	63	304	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	3.57e-10	10	288	2	306	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS11662.1|GH17	1.74e-142	1	294	97	391
QRW20708.1|GH17	1.73e-61	1	294	102	407
EGX45983.1|GH17	8.89e-60	1	293	377	668
CDS10168.1|GH17	6.05e-59	1	293	90	358
CCA75227.1|GH17	1.58e-57	1	293	29	335

PDB Hits     

PHYBL_99542T0-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DEV5|BTGC_NEOFI	4.94e-48	4	293	380	682	Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=btgC PE=3 SV=1
sp|B8NTP7|BTGC_ASPFN	1.25e-47	1	293	374	679	Probable glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=btgC PE=3 SV=2
sp|Q2U492|BTGC_ASPOR	1.25e-47	1	293	374	679	Probable glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=btgC PE=3 SV=1
sp|A2QN74|BTGC_ASPNC	2.37e-47	4	293	376	678	Putative glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=btgC PE=3 SV=2
sp|B0Y429|BTGC_ASPFC	2.46e-47	4	293	380	682	Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=btgC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000078	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PHYBL_99542T0-p1.