CAZyme Information: PHYBL_96036T0-p1

Basic Information

• Species: Phycomyces blakesleeanus
• Lineage: Mucoromycota; Mucoromycetes; ; Phycomycetaceae; Phycomyces; Phycomyces blakesleeanus
• CAZyme ID: PHYBL_96036T0-p1
• CAZy Family: GT57
• CAZyme Description: UDP-glucose:glycoprotein glucosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1430	PblaNRRL1555-_SC05|CGC4	162623.16	5.3817

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PblakesleeanusNRRL1555	16528	763407	0	16528

• Gene Location: location=PblaNRRL1555-_SC05:784096-789944(+)

Full Sequence      

ETVGMENETTYFSFISDLLHHSNSDSHTPQKLYQNCIKTVQDYGHASYPEGVESIKLSLS
LHLASPRVEAHHQVYTNSILPHLPAYDETCTVWAQAGDTQVCDVEKLEEVIKAMNKVDTK
SIVFPFDHILHPSQYTTDKDIPVIFVYTSELSPTFRKFHTFMTNAVEKYGVSYVVRYKPS
SSPDTPLYLTGYGVELALKNTDYLVIDDKAVQENKQKTFISKVSSFGRKVGHNLFETSKT
TIAPLTPEEIEKLGLKAAQFIITAENPFEALIHLSQDFPKYAKSISQIEMDDERVHEFKE
NQASMIRGGTNAIWFNGQSVEVEQVDPFYLVRVLKRERALIDSLKHIGFTSRQSIDLVSS
HALSHEDVHDTSSPKDVYDVREQGLAIWWNDIEKEERYEGWSDNMLDLLKPTYPGQLRTI
RRNIYNLLMVENLSSHAALTRLKNEVLEMVKRGTPIRFGLLPVIGDETSPATVAAKAVNY
IVREYGTNKAMDFASKKLEASLATIESAFTQTLATEGKPKSKEIKFFAQILNDEQDYIKE
VGVFLRKMGIAKDSEGAMFLNGKFLEFSDDTPWTRTLMQGLQEQTQLIANAIYYGSMQPK
ENIYNFLLTQFYVTGSRNPYIAPSESHPLKVLPVHKEFDAFKSLHYLQNTDQPGINTNLW
IVANLDTIQGLKLSLEALSFVETNNQTRVSLIHNPEACGHSSAILGNQKSEKALFSDVWY
SQIYGKITEIPKVKELLSAAIQSMEEEKGAKLINQVKSFSPGASIVRMFSREKAKDVKYI
CDAIGSFPIDVDFTAEDFSSLYSFEFTNRAEPIQNAFESVEKNVESDMLADTITLVNSIL
ETDKASMTTDVFDQGQTSNRQRPYEYLSGEKTSISIGDPSTAFIEIGATLDPLSEAAQRL
SHLLETLSGLSGVYIKIYMNPELEVKELPLKQFYRQVFDREPHFDKVGEIEVPMAYFTGL
PTDALYTLRVDTIKAWHVTVKEANMDLDNIQLTSLGAHQSSVSAVYELEHILLEGHCMDS
STHGPPRGLQFVLGTPSNPVTTDTIVMANLGYFQLKALPGVWRLGLREGPSNDMYHIESV
GTHGKWEKATPSSHRNSSDYTLLPLTSFEGLTVFPQVKHNEGVDPSQVLDHDTSSRYSTK
KKDEESDQLSSQPKQADINIFSVASGQLYERFLSIMIISVMEHTKSTVKFWFIEDFLSPS
FKDFLPEMAKEYKFDYEMVTYKWPSWLRSQKEKQRTIWGYKILFLDVLFPLSLDKVIFVD
ADQIVRADMKELVDMDLHGAPYGYTPFCSDRTEMDGFRFWTQGYWKEHLKERPYHISALY
VVDLVQFRRMAAGDRLRAQYQQLSADPHSLANLDQDLPNNMQHIVPIHSLPQEWLWCETW
CSDESLKSAKTIDLCNNPLTKEPKLDRARRQLPEWEVYDNQVSQLNKKVA

Enzyme Prediction     

EC	2.4.1.-:29

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT24	1158	1405	4.3e-134	0.9959677419354839

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408203	Glyco_transf_24	0.0	1158	1425	1	268	Glucosyltransferase 24. This is the catalytic domain found in UDP-glucose:glycoprotein glucosyltransferase (UGGT). This domain belongs to glucosyltransferase 24 family (GT24) A-type domain. The GT domain displays the expected glycosyltransferase type A (GT-A) fold.
133054	GT8_HUGT1_C_like	0.0	1158	1405	1	248	The C-terminal domain of HUGT1-like is highly homologous to the GT 8 family. C-terminal domain of glycoprotein glucosyltransferase (UGT). UGT is a large glycoprotein whose C-terminus contains the catalytic activity. This catalytic C-terminal domain is highly homologous to Glycosyltransferase Family 8 (GT 8) and contains the DXD motif that coordinates donor sugar binding, characteristic for Family 8 glycosyltransferases. GT 8 proteins are retaining enzymes based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. The non-catalytic N-terminal portion of the human UTG1 (HUGT1) has been shown to monitor the protein folding status and activate its glucosyltransferase activity.
408201	Thioredoxin_14	4.81e-62	376	621	2	248	Thioredoxin-like domain. This is the third out of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).
132996	Glyco_transf_8	3.81e-60	1158	1405	1	246	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
399437	UDP-g_GGTase	2.98e-50	1014	1130	1	109	UDP-glucose:Glycoprotein Glucosyltransferase. UDP-g_GGTase is an important, central component of the QC system in the ER for checking that glycoproteins are folded correctly. This QC prevents incorrectly folded glycoproteins from leaving the ER.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS05797.1|GT24	0.0	1	1429	41	1443
QDS71787.1|GT24	0.0	1	1428	50	1465
QBZ60625.1|GT24	0.0	1	1428	53	1471
QSS63494.1|GT24	0.0	1	1429	64	1477
CCT67477.1|GT24	0.0	1	1428	34	1428

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6TRT_A	3.84e-310	1	1429	30	1451	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5NV4_A	3.01e-309	1	1429	30	1451	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5MU1_A	4.24e-309	1	1429	30	1451	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5MZO_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TRF_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS8_A	1.81e-269	1	1367	23	1382	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS8_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS2_A	4.62e-257	1	1429	30	1217	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_C Chain C, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_D Chain D, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09140|UGGG_SCHPO	6.05e-272	11	1423	54	1422	UDP-glucose:glycoprotein glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpt1 PE=1 SV=2
sp|Q09332|UGGG_DROME	8.49e-235	28	1429	78	1511	UDP-glucose:glycoprotein glucosyltransferase OS=Drosophila melanogaster OX=7227 GN=Uggt PE=1 SV=2
sp|Q6P5E4|UGGG1_MOUSE	1.44e-232	1	1425	66	1523	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Mus musculus OX=10090 GN=Uggt1 PE=1 SV=4
sp|Q9NYU1|UGGG2_HUMAN	1.76e-231	52	1425	103	1498	UDP-glucose:glycoprotein glucosyltransferase 2 OS=Homo sapiens OX=9606 GN=UGGT2 PE=1 SV=4
sp|Q9NYU2|UGGG1_HUMAN	1.28e-230	56	1425	119	1523	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000067	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PHYBL_96036T0-p1.