CAZyme Information: PHYBL_87573T0-p1

Basic Information

• Species: Phycomyces blakesleeanus
• Lineage: Mucoromycota; Mucoromycetes; ; Phycomycetaceae; Phycomyces; Phycomyces blakesleeanus
• CAZyme ID: PHYBL_87573T0-p1
• CAZy Family: GT48
• CAZyme Description: Mannosyl-oligosaccharide alpha-1,2-mannosidase and related glycosyl hydrolases

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
549		62809.69	5.7687

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PblakesleeanusNRRL1555	16528	763407	0	16528

• Gene Location: location=PblaNRRL1555-_SC02:1447222-1449845(+)

Full Sequence      

PPPPPPPPPPPFDPLKGHTDFETNIPPIQRSFGTPPLHHVEKCEQRRLLVKKAFLHGWTG
YKTYAMGADELMPISNKSHNPFGGWGATLVDSLSTLLIMELDSEVELALTNITALNFTIN
ENISVFESTIRYLGGFLSAYELSEQKYPVLLDKAISLANTLLPAFDSPSGLPYHHWNTAT
KKSPNQNTFFAEAGTVQLEFMMLTRHTGNPVYQEKAQAITDLLDRMGYEHGLRIPGLYPS
EMDTRGRFKKSMVSFGAMGDSAFEYFLKEHLLVEGENPQYARMYTESIDSMTHHMLRQLS
GTPLLYLPPYNSITRTPDSYMDHLTCFVPGMLAMGAKVLDRPQDMILAKGLLETCVYMYR
HTNTGLSPEIWSIAGTEPYDRLTYNRTKEELDYARNWWFKPNATIPPPPSIPPAQVPEEE
LYPENYVLGPMVLASDHLRIIDWRYLLRPETVESIYILYRITGDPKYQEWGWDIFEAIEK
HCKTPSAYAVVRNVLQYTNAEHPYMNHADSMESFLFAETFKYLYLLFSPPDIISLDHFVF
NTEAHPFRR

Enzyme Prediction     

EC	3.2.1.113:7

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	53	549	2.4e-151	0.9977578475336323

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	0.0	53	549	1	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	2.06e-147	41	549	67	518	glycoside hydrolase family 47 protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS13087.1|GH47	1.01e-208	19	549	53	577
AMJ52391.1|GH47	2.30e-126	44	549	101	565
QGA19170.1|GH47	8.07e-120	19	549	72	586
QVM13228.1|GH47	6.65e-110	25	549	67	579
QSS49989.1|GH47	9.58e-108	19	546	69	582

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5KKB_A	2.29e-80	45	547	21	465	Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus],5KKB_B Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus]
1NXC_A	2.92e-80	45	547	19	463	Structure of mouse Golgi alpha-1,2-mannosidase IA reveals the molecular basis for substrate specificity among Class I enzymes (family 47 glycosidases) [Mus musculus]
5KIJ_A	8.50e-79	54	546	13	448	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]
1FMI_A	1.00e-78	54	546	18	453	Crystal Structure Of Human Class I Alpha1,2-Mannosidase [Homo sapiens]
1X9D_A	1.05e-78	25	546	73	531	Crystal Structure Of Human Class I alpha-1,2-Mannosidase In Complex With Thio-Disaccharide Substrate Analogue [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8H116|MNS2_ARATH	2.52e-82	45	548	97	536	Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS2 OS=Arabidopsis thaliana OX=3702 GN=MNS2 PE=1 SV=1
sp|Q9C512|MNS1_ARATH	5.51e-81	44	548	95	535	Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS1 OS=Arabidopsis thaliana OX=3702 GN=MNS1 PE=1 SV=1
sp|P45701|MA1A1_RABIT	2.51e-78	45	545	10	452	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA (Fragment) OS=Oryctolagus cuniculus OX=9986 GN=MAN1A1 PE=1 SV=1
sp|P45700|MA1A1_MOUSE	1.07e-77	45	547	196	640	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA OS=Mus musculus OX=10090 GN=Man1a1 PE=1 SV=1
sp|Q18788|MAN12_CAEEL	1.34e-77	27	546	113	584	Mannosyl-oligosaccharide 1,2-alpha-mannosidase C52E4.5 OS=Caenorhabditis elegans OX=6239 GN=C52E4.5 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000049	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PHYBL_87573T0-p1.