CAZyme Information: PHYBL_80073T0-p1

Basic Information

• Species: Phycomyces blakesleeanus
• Lineage: Mucoromycota; Mucoromycetes; ; Phycomycetaceae; Phycomyces; Phycomyces blakesleeanus
• CAZyme ID: PHYBL_80073T0-p1
• CAZy Family: GT4
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
402		45202.01	8.6310

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PblakesleeanusNRRL1555	16528	763407	0	16528

• Gene Location: location=PblaNRRL1555-_SC01:3978271-3979861(-)

Full Sequence      

MGPKKPEIEWIDLNKVRPFQSSIETKEAHDCLRRLARNSLKSGPFNIVKDKVAPHIAASN
DPHDFLSYAPYWWPVEKTTTLSDGTTHTQVDYVRKDGKRNPDTKLVQDQSQLEAFAENLA
HLCLGYRVFGDESYAQHAVFLLNEFFVNPNTRMNPNVNYGQVVRGSSNKTRIGRYTGLIS
TRSLARVANVLPSLDDYSGYKPIEESVNRWFSVYLTWMKTSPVAHGATTSKNNHHSWYIA
QVVAIQILLDRGHCKAKRTLETFFKSIVPKQINASSGDQPLESNRALPFHYLVFNIKAIL
FLAQAGRSIGLDFYPQNNRLIELAINYIAGFGDSTTTAADNAKTTDLTDAVRVMQIASNV
CGDTYGAYHNFVETAKSCQFSENISGPKNAIHPLWCYVNTDQ

Enzyme Prediction     

No EC number prediction in PHYBL_80073T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL38	54	332	1.9e-76	0.9605734767025089

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398861	Alginate_lyase	6.20e-52	48	329	2	265	Alginate lyase. This family contains several bacterial alginate lyase proteins. Alginate is a family of 1-4-linked copolymers of beta -D-mannuronic acid (M) and alpha -L-guluronic acid (G). It is produced by brown algae and by some bacteria belonging to the genera Azotobacter and Pseudomonas. Alginate lyases catalyze the depolymerization of alginates by beta -elimination, generating a molecule containing 4-deoxy-L-erythro-hex-4-enepyranosyluronate at the nonreducing end. This family adopts an all alpha fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AFA26126.1|PL38	1.02e-121	1	399	1	384
AFA26122.1|PL38	1.44e-121	1	399	1	384
CDS07499.1|PL38	2.33e-117	1	396	1	380
QRW24462.1|PL38	3.72e-50	25	372	44	391
KGB74556.1|PL38	1.64e-48	21	312	46	337

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NFV_A	2.24e-34	13	328	14	317	Crystal structure of an alginate lyase (BACOVA_01668) from Bacteroides ovatus at 1.95 A resolution [Bacteroides ovatus ATCC 8483],3NNB_A Crystal structure of an alginate lyase (BACOVA_01668) from Bacteroides ovatus at 1.60 A resolution [Bacteroides ovatus ATCC 8483]

Swiss-Prot Hits     

PHYBL_80073T0-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000048	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PHYBL_80073T0-p1.