CAZyme Information: PHYBL_75565T0-p1

Basic Information

• Species: Phycomyces blakesleeanus
• Lineage: Mucoromycota; Mucoromycetes; ; Phycomycetaceae; Phycomyces; Phycomyces blakesleeanus
• CAZyme ID: PHYBL_75565T0-p1
• CAZy Family: GT31
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
337	PblaNRRL1555-_SC02|CGC5	36372.49	8.6540

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PblakesleeanusNRRL1555	16528	763407	0	16528

• Gene Location: location=PblaNRRL1555-_SC02:1605723-1606794(+)

Full Sequence      

MHLSLNFLLLASGFLGSVVSAANSINVCSSCTYKTVSAALASLPNNSATWTIYVAPGTYN
EQIKIRRSNVILKPSTSGTVQIQHNGMRDTQSSSGTNEQSATLSVYGSNVKVYNMIIANI
YPQTRNIANLALNLQATQASFYNVKFYGFQDTVLIALGTTSYFKNCYIEGSVDYIWGYGT
AYFDHTTVATNQRGGFITAHNRQTANAVGGFYFNSCTAIATLPSGPLKATANSALSFTST
SQFPQSTYLGRPWSQYARVIFIYSELGAHINPVGWTQWSSSSPNTDGVLFGEYSNTGDGK
WNDSSRASFATLLTASQAAYYSIGNVLGSTSWIDTSV

Enzyme Prediction     

No EC number prediction in PHYBL_75565T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	30	327	3.8e-72	0.9618055555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215357	PLN02665	5.31e-49	33	333	80	360	pectinesterase family protein
395871	Pectinesterase	5.67e-42	30	328	9	296	Pectinesterase.
178051	PLN02432	1.27e-37	33	333	23	292	putative pectinesterase
178372	PLN02773	6.89e-37	33	321	17	290	pectinesterase
215367	PLN02682	1.77e-36	33	333	82	367	pectinesterase family protein

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQK47705.1|CE8	1.55e-66	33	334	91	382
QKD59401.1|CE8	8.34e-61	33	334	1168	1461
CCT74155.1|CE8	2.09e-60	33	334	1107	1400
QGI68927.1|CE8	2.09e-60	33	334	1132	1425
QGI99816.1|CE8	2.09e-60	33	334	1132	1425

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1E_A	3.86e-36	32	336	18	298	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	2.06e-35	32	336	18	298	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
1GQ8_A	2.87e-23	33	333	19	308	Pectin methylesterase from Carrot [Daucus carota]
1XG2_A	5.28e-23	33	333	15	304	Chain A, Pectinesterase 1 [Solanum lycopersicum]
3UW0_A	3.86e-16	33	290	44	318	Pectin methylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12535|PME_ASPAC	1.91e-37	33	336	37	329	Pectinesterase OS=Aspergillus aculeatus OX=5053 GN=pme1 PE=2 SV=1
sp|A2QK82|PMEA_ASPNC	1.88e-35	32	336	46	326	Probable pectinesterase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pmeA PE=3 SV=1
sp|Q4WBT5|PMEA_ASPFU	2.61e-33	22	336	33	323	Probable pectinesterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pmeA PE=3 SV=1
sp|B0Y9F9|PMEA_ASPFC	2.61e-33	22	336	33	323	Probable pectinesterase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=pmeA PE=3 SV=1
sp|Q5B7U0|PMEA_EMENI	3.71e-33	22	336	34	324	Pectinesterase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pmeA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000278	0.999689	CS pos: 21-22. Pr: 0.8653

TMHMM  Annotations     

There is no transmembrane helices in PHYBL_75565T0-p1.