CAZyme Information: PHYBL_70622T0-p1

Basic Information

• Species: Phycomyces blakesleeanus
• Lineage: Mucoromycota; Mucoromycetes; ; Phycomycetaceae; Phycomyces; Phycomyces blakesleeanus
• CAZyme ID: PHYBL_70622T0-p1
• CAZy Family: GT22
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
358		39790.17	4.5883

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PblakesleeanusNRRL1555	16528	763407	0	16528

• Gene Location: location=PblaNRRL1555-_SC18:247296-249118(+)

Full Sequence      

MIGVYTVALFSVILFGLLESISCLGLTLDQCDCGFKDENDRIWTNMWFEDYTKDIASPHE
DHDYLVMNYTVKSIRPTTLDRLFDPNNVQLTDGGIDMTVKSDDSGTFTSASFGSRRTDIL
YGTYRINVKTSDVPGTIAAMFIRNDNTEIDIELLSQYKDPAKVHYAVHPQIYESNGSPSP
LTFGLKDLSFDPTEEFHEYRLDWLPEIVEYFTDGVPTHQLSKNIPEKPGRVVINHWTDGN
PNFGGALPTEPAVLSVSKFVMMFNVTGNTEPLACQKSANACSIHDVTEEQILPENIAMPS
SSMPSKRSPTNSTSLPLSTSLGRKPLDNQDLLVKKVIGRCLSILLFTGIIIAIAIAIF

Enzyme Prediction     

No EC number prediction in PHYBL_70622T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	86	258	6.7e-51	0.9427083333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185683	Glyco_hydrolase_16	2.41e-40	83	261	27	209	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
395585	Glyco_hydro_16	5.52e-20	83	249	1	163	Glycosyl hydrolases family 16.
185684	GH16_lichenase	1.55e-19	85	246	31	194	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.
185693	GH16_laminarinase_like	2.12e-07	84	223	36	187	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
225182	BglS	3.43e-07	86	249	79	247	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS07094.1|GH16_23	8.32e-86	31	293	31	300
CDS07155.1|GH16_23	4.03e-59	30	288	40	311
QKD52214.1|GH16	5.11e-38	30	283	7	265
QDS77245.1|GH16_23	3.78e-33	26	285	17	281
CZS84016.1|GH16_23	3.61e-29	21	287	9	306

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1MAC_A	1.44e-14	86	248	35	199	Crystal Structure And Site-Directed Mutagenesis Of Bacillus Macerans Endo-1,3-1,4-Beta-Glucanase [Paenibacillus macerans],1MAC_B Crystal Structure And Site-Directed Mutagenesis Of Bacillus Macerans Endo-1,3-1,4-Beta-Glucanase [Paenibacillus macerans]
1BYH_A	1.49e-14	86	248	37	201	MOLECULAR AND ACTIVE-SITE STRUCTURE OF A BACILLUS (1-3,1-4)-BETA-GLUCANASE [synthetic construct],1GLH_A Cation Binding To A Bacillus (1,3-1,4)-Beta-Glucanase. Geometry, Affinity And Effect On Protein Stability [Paenibacillus macerans],2AYH_A Crystal And Molecular Structure At 1.6 Angstroms Resolution Of The Hybrid Bacillus Endo-1,3-1,4-Beta-D-Glucan 4- Glucanohydrolase H(A16-M) [hybrid]
3WVJ_A	1.65e-14	82	236	34	186	Chain A, Beta-glucanase [Acetivibrio thermocellus ATCC 27405],3WVJ_B Chain B, Beta-glucanase [Acetivibrio thermocellus ATCC 27405]
1U0A_A	9.63e-14	86	248	37	201	Chain A, Beta-glucanase [Paenibacillus macerans],1U0A_B Chain B, Beta-glucanase [Paenibacillus macerans],1U0A_C Chain C, Beta-glucanase [Paenibacillus macerans],1U0A_D Chain D, Beta-glucanase [Paenibacillus macerans]
3I4I_A	9.71e-14	87	236	56	204	Crystal structure of a prokaryotic beta-1,3-1,4-glucanase (lichenase) derived from a mouse hindgut metagenome [uncultured murine large bowel bacterium BAC 14],3I4I_B Crystal structure of a prokaryotic beta-1,3-1,4-glucanase (lichenase) derived from a mouse hindgut metagenome [uncultured murine large bowel bacterium BAC 14]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P45797|GUB_PAEPO	8.32e-14	86	236	61	208	Beta-glucanase OS=Paenibacillus polymyxa OX=1406 GN=gluB PE=3 SV=1
sp|P23904|GUB_PAEMA	1.12e-13	86	248	60	224	Beta-glucanase OS=Paenibacillus macerans OX=44252 PE=1 SV=2
sp|A3DBX3|GUB_ACET2	3.30e-13	82	236	63	215	Beta-glucanase OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=licB PE=1 SV=1
sp|Q84C00|GUB_ACETH	1.47e-12	82	236	63	215	Beta-glucanase OS=Acetivibrio thermocellus OX=1515 GN=licB PE=1 SV=1
sp|P27051|GUB_BACLI	4.86e-12	121	236	101	213	Beta-glucanase OS=Bacillus licheniformis OX=1402 GN=bg1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000798	0.999178	CS pos: 23-24. Pr: 0.9643

TMHMM  Annotations     

Start	End
4	26
340	357