CAZyme Information: PHYBL_60464T0-p1

Basic Information

• Species: Phycomyces blakesleeanus
• Lineage: Mucoromycota; Mucoromycetes; ; Phycomycetaceae; Phycomyces; Phycomyces blakesleeanus
• CAZyme ID: PHYBL_60464T0-p1
• CAZy Family: GT2
• CAZyme Description: Predicted glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
499	PblaNRRL1555-_SC04|CGC3	57388.17	7.0467

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PblakesleeanusNRRL1555	16528	763407	0	16528

• Gene Location: location=PblaNRRL1555-_SC04:335878-337641(+)

Full Sequence      

MERFKALKSWTSTSPPNESIYTVRRHYRNSSTSLDEFESHTPKLRSHRLRLALLLTSLLI
LFRWWMFPIRHGKLRDQPIYEQPKACQAKMCNPAGRCSTWSTASGAVNWTGLVENGLYRD
LGKINVDPGCEVELRVDGEGPRPEQGWMRMEGNTSCVDEYGQTGWVPECRNLVSMQVKDR
YNEEIVMNHIPSSVDPFDITLVTQFSVNRLNTFNKVLDVWKGPISIAIYLTEEGDIDELD
EFLKIPENFKAYEHIHLTLVKPPYNTLDRLAYPINHLRNLAWAASTTDYILVIDADFVPS
PNLHNFLQEQYTRMSKSPKIAWVVPCFGLVSDYPIPTKVSTIRNALDNKKAYITDPGAGH
GPTLYRQLGLSHGFHVYDEVCYESQWEPYYVISRHTPMYDVRFKNQGGDKQSHALQLNSE
QYTFRVWRNVFLAHQEHTSMVWPGQGKIEPPEWNYFGGFMREMESIYGPNVRWPRGCNAA
GVGWQDQGRPTLGLGVIMA

Enzyme Prediction     

EC	2.4.1.-:23	2.4.2.-:23

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT49	186	438	1.9e-47	0.7507418397626113

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404735	Glyco_transf_49	2.57e-37	198	435	1	291	Glycosyl-transferase for dystroglycan. This glycosyl-transferase brings about the glycosylation of the alpha-dystroglycan subunit. Dystroglycan is an integral member of the skeletal muscular dystrophin glycoprotein complex, which links dystrophin to proteins in the extracellular matrix.
133043	CESA_CelA_like	9.96e-05	228	325	36	120	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
395426	Glycos_transf_2	2.31e-04	278	367	70	161	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
132997	Glyco_tranf_GTA_type	0.001	240	321	38	109	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
133045	CESA_like	0.006	279	321	71	110	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS10282.1|GT49	1.54e-114	22	494	29	526
CDR43695.1|GT49	4.77e-65	158	479	144	554
CRX78931.1|GT49	4.75e-60	119	493	131	579
ADY42842.1|GT49|GT8	1.46e-27	180	472	390	672
ADI96183.1|GT49|GT8	4.48e-26	187	437	378	626

PDB Hits     

PHYBL_60464T0-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6P7A1|LARG2_RAT	8.71e-27	187	437	390	638	Xylosyl- and glucuronyltransferase LARGE2 OS=Rattus norvegicus OX=10116 GN=Large2 PE=2 SV=1
sp|Q5XPT3|LARG2_MOUSE	3.75e-26	189	437	393	638	Xylosyl- and glucuronyltransferase LARGE2 OS=Mus musculus OX=10090 GN=Large2 PE=1 SV=1
sp|Q66PG4|LARG2_CHICK	7.32e-26	195	437	453	691	Xylosyl- and glucuronyltransferase LARGE2s OS=Gallus gallus OX=9031 GN=LARGE2 PE=2 SV=1
sp|Q6PA90|LRG2A_XENLA	1.28e-25	189	437	431	675	Xylosyl- and glucuronyltransferase LARGE2s OS=Xenopus laevis OX=8355 GN=large2-a PE=2 SV=1
sp|Q66PG1|LARG2_DANRE	1.01e-24	195	437	464	702	Xylosyl- and glucuronyltransferase LARGE2s OS=Danio rerio OX=7955 GN=large2 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999951	0.000037

TMHMM  Annotations     

Start	End
49	67