CAZyme Information: PHYBL_59653T0-p1

Basic Information

• Species: Phycomyces blakesleeanus
• Lineage: Mucoromycota; Mucoromycetes; ; Phycomycetaceae; Phycomyces; Phycomyces blakesleeanus
• CAZyme ID: PHYBL_59653T0-p1
• CAZy Family: GT2
• CAZyme Description: Predicted glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
427	PblaNRRL1555-_SC06|CGC1	49884.31	6.8175

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PblakesleeanusNRRL1555	16528	763407	0	16528

• Gene Location: location=PblaNRRL1555-_SC06:1220177-1222265(+)

Full Sequence      

MRPGIAQTCSKMGKYFLIVYALASVIYTAHYFYTTYDRTSTSEKPLSAFAHVEPQNRHVQ
QEHLRGFSSNVNWASGQDVVQSVSEDFILSKVFSDAMGPSNVMSYYYKASSSFEQEDITM
STLVTRNRFMVLSRLASHYKGPISAAIHVNDDETKELVLQELEEMVATNPDVRKFVDIHL
ILDNFDRQFNMWRNVAKLFARTDYVMMLDVDFHLCTDFRQRIRTNPEIMDKLRSGRAAFV
VPAFEFTVQDDGLNSTTFPASKEALIKEVDSGKLDMFHKSWLRGHGSTNYARWYPSQEIY
QVDTYDFSYEPYIIYKKNGTPWCDERFIGYGANKAACLYEIYLSGVDYWVLPEDFLIHQT
HKYLEEARRKERQYNRKLYSNFREEICLRYSRMFYSSGEWDTDRASNLKGECEKIRGFRS
TMHASTL

Enzyme Prediction     

No EC number prediction in PHYBL_59653T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT49	111	393	1.8e-49	0.827893175074184

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404735	Glyco_transf_49	1.51e-55	117	390	1	326	Glycosyl-transferase for dystroglycan. This glycosyl-transferase brings about the glycosylation of the alpha-dystroglycan subunit. Dystroglycan is an integral member of the skeletal muscular dystrophin glycoprotein complex, which links dystrophin to proteins in the extracellular matrix.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS06217.1|GT49	2.66e-202	1	422	1	431
CDS10115.1|GT49	1.25e-194	1	427	1	431
CDS09884.1|GT49	2.48e-192	47	423	10	391
CDS06289.1|GT49	1.18e-174	1	423	1	425
CDS14203.1|GT49	1.06e-173	11	419	9	421

PDB Hits     

PHYBL_59653T0-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5XPT3|LARG2_MOUSE	4.63e-30	114	361	399	638	Xylosyl- and glucuronyltransferase LARGE2 OS=Mus musculus OX=10090 GN=Large2 PE=1 SV=1
sp|Q66PG1|LARG2_DANRE	9.52e-30	107	361	457	702	Xylosyl- and glucuronyltransferase LARGE2s OS=Danio rerio OX=7955 GN=large2 PE=2 SV=1
sp|Q6P7A1|LARG2_RAT	2.80e-29	117	361	401	638	Xylosyl- and glucuronyltransferase LARGE2 OS=Rattus norvegicus OX=10116 GN=Large2 PE=2 SV=1
sp|Q9Z1M7|LARG1_MOUSE	1.04e-28	106	361	462	708	Xylosyl- and glucuronyltransferase LARGE1 OS=Mus musculus OX=10090 GN=Large1 PE=1 SV=1
sp|O95461|LARG1_HUMAN	1.12e-27	106	361	462	708	Xylosyl- and glucuronyltransferase LARGE1 OS=Homo sapiens OX=9606 GN=LARGE1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000016	0.000002

TMHMM  Annotations     

Start	End
12	34