CAZyme Information: PHYBL_58625T0-p1

Basic Information

• Species: Phycomyces blakesleeanus
• Lineage: Mucoromycota; Mucoromycetes; ; Phycomycetaceae; Phycomyces; Phycomyces blakesleeanus
• CAZyme ID: PHYBL_58625T0-p1
• CAZy Family: GT2
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
337		36461.74	7.0318

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PblakesleeanusNRRL1555	16528	763407	0	16528

• Gene Location: location=PblaNRRL1555-_SC02:1602310-1603377(+)

Full Sequence      

MYFSINLVILACGFLGSFVFAANSVDVCSSCTYKSVTSALDSLPADSTVWTISIAPGTYT
EQVKISRSNVILKPSASGKVQIQYNGMRDTQTSTGTNEQSATISVYGSNVKIYDMIIANI
YPQTTNIANLALNLQATQASFYNVKFYGFQDTVLIATGATSYFKSCYIEGSVDYIWGYGV
AYFEATTLGTNKRGGYITAHKRKDATSVGGFYFNGCTVIPTIPSGPLTSTADPSQSFTSA
SQFPNSCYLGRPWNQYARVVYMNSELYSHINSGGWAKWSTSSPNTDGVLFGEYNNSGPGK
WNATTRVSFATLLTETEASSYSLGSIFGSINWIDTIA

Enzyme Prediction     

No EC number prediction in PHYBL_58625T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	27	325	9.1e-73	0.9652777777777778

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215357	PLN02665	2.78e-49	33	329	80	357	pectinesterase family protein
395871	Pectinesterase	5.20e-38	30	325	9	293	Pectinesterase.
215367	PLN02682	4.60e-37	33	333	82	367	pectinesterase family protein
178051	PLN02432	2.24e-34	25	333	15	292	putative pectinesterase
178372	PLN02773	1.12e-33	33	321	17	290	pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQK47705.1|CE8	1.10e-66	33	337	91	385
QRD05746.1|CE8	1.45e-66	31	337	434	733
CCT74155.1|CE8	2.84e-60	33	334	1107	1400
QGI68927.1|CE8	2.85e-60	33	334	1132	1425
QGI99816.1|CE8	2.85e-60	33	334	1132	1425

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1E_A	2.26e-32	32	334	18	296	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	1.19e-31	32	334	18	296	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
1GQ8_A	3.17e-25	33	333	19	308	Pectin methylesterase from Carrot [Daucus carota]
1XG2_A	1.90e-22	33	299	15	268	Chain A, Pectinesterase 1 [Solanum lycopersicum]
3UW0_A	7.17e-20	33	299	44	334	Pectin methylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P17872|PME_ASPNG	7.77e-35	33	335	37	327	Pectinesterase OS=Aspergillus niger OX=5061 GN=pme1 PE=1 SV=1
sp|Q12535|PME_ASPAC	4.10e-34	33	335	37	328	Pectinesterase OS=Aspergillus aculeatus OX=5053 GN=pme1 PE=2 SV=1
sp|Q84WM7|PPME1_ARATH	3.87e-32	33	333	76	355	Pectinesterase PPME1 OS=Arabidopsis thaliana OX=3702 GN=PPME1 PE=1 SV=1
sp|A2QK82|PMEA_ASPNC	2.06e-31	32	334	46	324	Probable pectinesterase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pmeA PE=3 SV=1
sp|Q4WBT5|PMEA_ASPFU	3.76e-31	22	335	33	322	Probable pectinesterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000360	0.999611	CS pos: 21-22. Pr: 0.9705

TMHMM  Annotations     

There is no transmembrane helices in PHYBL_58625T0-p1.