CAZyme Information: PHYBL_56514T0-p1

Basic Information

• Species: Phycomyces blakesleeanus
• Lineage: Mucoromycota; Mucoromycetes; ; Phycomycetaceae; Phycomyces; Phycomyces blakesleeanus
• CAZyme ID: PHYBL_56514T0-p1
• CAZy Family: GT2
• CAZyme Description: Chitinase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
393		43946.16	6.0747

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PblakesleeanusNRRL1555	16528	763407	0	16528

• Gene Location: location=PblaNRRL1555-_SC02:2411457-2413672(+)

Full Sequence      

MAIRSIASTSVMQKGAIYDRNYNVIDLARDSDKLSHVLYAFADLNDDGTIVLGDAWADTD
KHFEASQTVDGHKDTWKEAPDNNLYGNLKQLHLLKKNKRHLKVSLSIGGWSWSTNFSTIA
TNTQKRHQFATTAVEHVATLGLDGIDIDWEFPKNANEAEGYVELLSAVRQALDSYQHETK
DKDRFLLSVAMPCGPDNYNILKLGAMEPFVDLFYLMAYDFSGDWDKTTGHQSALFDAPLN
VDQAVRHFIKAGVPSHKLVLGLPVYGRGFLGAKGPGSAFTSLPKGTWDLGAYDYKDLPPP
GSSEYFDEAKVASWSFNPTSKEYVTYDTPEVIEHKCDYIKSKGLGGAMFWELSADYHGDH
PRSLLNTVHRKLGSPDQTPNHIEFPNSRYENIK

Enzyme Prediction     

EC	3.2.1.14:58

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	18	366	9.2e-76	0.9324324324324325

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119365	GH18_chitinase	7.99e-120	16	355	9	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
214753	Glyco_18	9.19e-105	16	355	10	334	Glyco_18 domain.
395573	Glyco_hydro_18	4.59e-87	30	355	19	307	Glycosyl hydrolases family 18.
225862	ChiA	3.15e-83	16	373	48	437	Chitinase, GH18 family [Carbohydrate transport and metabolism].
119351	GH18_chitolectin_chitotriosidase	1.92e-69	36	372	30	362	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS14181.1|GH18	1.90e-164	17	393	22	400
BAA13489.1|GH18|3.2.1.14	1.81e-151	17	393	21	396
CDS03378.1|GH18	6.18e-144	16	393	64	433
VBB76788.1|GH18	7.88e-119	17	393	55	423
CAP70094.1|GH18	3.17e-118	17	393	55	423

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6IGY_A	3.77e-116	16	393	26	400	Crystal structure of Aspergillus niger chitinase B [Aspergillus niger]
1D2K_A	3.13e-113	16	393	13	387	Chain A, CHITINASE 1 [Coccidioides immitis],1LL4_A Chain A, Chitinase 1 [Coccidioides immitis],1LL4_B Chain B, Chitinase 1 [Coccidioides immitis],1LL4_C Chain C, Chitinase 1 [Coccidioides immitis],1LL4_D Chain D, Chitinase 1 [Coccidioides immitis]
1LL7_A	8.88e-113	16	393	13	387	Chain A, CHITINASE 1 [Coccidioides immitis],1LL7_B Chain B, CHITINASE 1 [Coccidioides immitis]
1LL6_A	1.78e-112	16	393	13	387	Chain A, CHITINASE 1 [Coccidioides immitis],1LL6_B Chain B, CHITINASE 1 [Coccidioides immitis],1LL6_C Chain C, CHITINASE 1 [Coccidioides immitis],1LL6_D Chain D, CHITINASE 1 [Coccidioides immitis]
6EPB_A	1.99e-108	17	393	49	419	Structure of Chitinase 42 from Trichoderma harzianum [Trichoderma harzianum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|G5EAZ3|CHIB1_EMENI	4.64e-116	16	393	14	392	Endochitinase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=chiB PE=1 SV=1
sp|Q92222|CHIB_EMEND	4.64e-116	16	393	14	392	Endochitinase B OS=Emericella nidulans OX=162425 GN=chiB PE=1 SV=3
sp|P32470|CHI1_APHAL	1.53e-112	17	393	49	419	Chitinase 1 OS=Aphanocladium album OX=12942 GN=CHI1 PE=1 SV=2
sp|E9ERT9|CHI1_METRA	3.16e-112	17	393	50	420	Endochitinase 1 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) OX=655844 GN=chit1 PE=3 SV=1
sp|P0CB51|CHI1_COCPS	4.92e-112	16	393	48	422	Endochitinase 1 OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) OX=443226 GN=CTS1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000045	0.000002

TMHMM  Annotations     

There is no transmembrane helices in PHYBL_56514T0-p1.