CAZyme Information: PHYBL_187561T0-p1

Basic Information

• Species: Phycomyces blakesleeanus
• Lineage: Mucoromycota; Mucoromycetes; ; Phycomycetaceae; Phycomyces; Phycomyces blakesleeanus
• CAZyme ID: PHYBL_187561T0-p1
• CAZy Family: GT15
• CAZyme Description: Predicted Dolichyl-phosphate-mannose-protein mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
426	PblaNRRL1555-_SC14|CGC4	48457.77	9.3860

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PblakesleeanusNRRL1555	16528	763407	0	16528

• Gene Location: location=PblaNRRL1555-_SC14:1240648-1242650(+)

Full Sequence      

MKTLDQVYAIATTSRLITITIGVISFLFAGSYDTSAEIQLSAHVIPQSFIQRCLTAFLRW
DALYFLHIAEHGYVYEQEYAFFPVMPIASRLVANTVLYPFQSMLGGQQYSLLFGGVIVAN
VSFVLAAGSLFKLSQSVFGGNQRMSFVSAVAFCISPPSMFMSSLYTESLFAYMSFTGMYL
VLQSHYMSASIIWGITSGLRSNAIIYSGFFFYDFVVIRLVRKQGIKRLCAGLVLAILYSI
PVFSGFGLFQYYGYTQFCTNGNDRPWCHERVPILYTFVQKEYWNNGFLTYYEIKQIPNFL
LATPIITLSVYGLWTYAKNDFKGFFTLGLYTKVQERKNLYTTKKVAVFMYLWSALLVYTA
TCMHIQVIIRFFTSLPPLYWFTAHLWINGLGPSASKNYWISKGLLSYFVLYGLVGIVLFS
TFLPPA

Enzyme Prediction     

No EC number prediction in PHYBL_187561T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	10	426	1.7e-110	0.9901719901719902

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	1.91e-67	11	426	8	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	3.49e-18	59	426	76	408	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS09540.1|GT76	2.82e-152	1	426	1	392
BBN03197.1|GT76	1.41e-68	7	424	15	480
AFP03088.1|GT76	5.96e-63	50	424	10	455
AFE66668.1|GT76	3.06e-60	33	424	35	491
AFI33569.1|GT76	3.06e-60	33	424	35	491

PDB Hits     

PHYBL_187561T0-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5KR61|PIGV_RAT	2.86e-60	6	424	10	490	GPI mannosyltransferase 2 OS=Rattus norvegicus OX=10116 GN=Pigv PE=2 SV=1
sp|Q7TPN3|PIGV_MOUSE	1.57e-59	6	424	10	491	GPI mannosyltransferase 2 OS=Mus musculus OX=10090 GN=Pigv PE=2 SV=2
sp|Q9NUD9|PIGV_HUMAN	8.42e-59	33	424	35	491	GPI mannosyltransferase 2 OS=Homo sapiens OX=9606 GN=PIGV PE=1 SV=1
sp|Q4WQ21|GPI18_ASPFU	1.20e-42	32	426	56	441	GPI mannosyltransferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi18 PE=3 SV=1
sp|Q4I0K3|GPI18_GIBZE	3.18e-42	32	426	38	423	GPI mannosyltransferase 2 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000009	0.000005

TMHMM  Annotations     

Start	End
7	29
109	131
144	166
189	211
232	254
295	317
346	368
404	423