CAZyme Information: PHYBL_185781T0-p1

Basic Information

• Species: Phycomyces blakesleeanus
• Lineage: Mucoromycota; Mucoromycetes; ; Phycomycetaceae; Phycomyces; Phycomyces blakesleeanus
• CAZyme ID: PHYBL_185781T0-p1
• CAZy Family: GT15
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
791	PblaNRRL1555-_SC05|CGC2	89409.94	9.6954

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PblakesleeanusNRRL1555	16528	763407	0	16528

• Gene Location: location=PblaNRRL1555-_SC05:411087-413613(+)

Full Sequence      

MAPPPPNSVDGSFFGNTSCPTYRRGSLTTSLMAVPMHYSHSHSHNNHNHNHNHSKTQTHR
QPSASLISRLRQPFFRSDKRWRWWHALAALLVFLGLVELVALMTGWALLQDDIQPGRIAV
RQYPAMSYRHLNTSAPINLSSDTVVFHITEEFGLANTGSLGAAVTALAAAQQKSGLAQVS
VVMPFYSFLKNKYTLKRSADLIIDIRDKDNRPVPIEFRVWKTEHVFATSPNATSTTSIPL
YLIGPGNRPPFSQAFRAKNALHINSPQKGLPREWRDQYFGKAAAAFVAHRTSAMDEVSLF
APMETVARVDVVHLHGATTAYAAKHMRDRRDTNQLGPKPPVFVYTLHEYNRELQHAHSIN
SVQKFLDDPALFVNARTSNQNKAFLQRARQVIESQSYTHNQRVFLSGLAVASADMVTVAS
QSMASDMVQGILDVPMKEMMMDSLLLKAQNRRFFGVSHGINFDNVSPFTHPKLIQRGLSF
PNHALNLIQQQSVPARQTAPTQRSQWTLGASPNDFVSTSKDRAKRFLVRRKLLSEEDSKR
PMVLFTGTFHYSNGAASFEEAAIYFQKYNMRLVLLGQPGDYPFEKLEALQAKYPETVLIL
ATPKEYRQWSVLCRAAADVLFVPGHPGTSLSAIEGMLYGASVLSTGSGSLRDILIDRPVW
KEEQNQENEFKRDIRIMRNKETKIPTVASLEHFNAYLFDDKTKTSLEKAIFDLSNDLAKT
TESKALREEYCLRMIHSAMALDWERPQGPMEEYMQVYEVALLDRKLPSLTQHVVEEEEFV
LNRLMLQDQQL

Enzyme Prediction     

No EC number prediction in PHYBL_185781T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	145	758	1.3e-33	0.9936440677966102

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340822	GT5_Glycogen_synthase_DULL1-like	1.76e-07	145	758	2	473	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
223374	GlgA	1.28e-06	145	660	3	413	Glycogen synthase [Carbohydrate transport and metabolism].
223515	RfaB	1.61e-05	536	682	195	345	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
340816	Glycosyltransferase_GTB-type	4.41e-05	544	659	114	231	glycosyltransferase family 1 and related proteins with GTB topology. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. The structures of the formed glycoconjugates are extremely diverse, reflecting a wide range of biological functions. The members of this family share a common GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
400563	Glyco_transf_5	6.31e-05	145	355	1	172	Starch synthase catalytic domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS06183.1|GT0	1.11e-202	1	784	1	825
CDS14426.1|GT0	3.20e-153	1	764	2	723
CDR38054.1|GT0	2.71e-81	96	765	90	809

PDB Hits     

PHYBL_185781T0-p1 has no PDB hit.

Swiss-Prot Hits     

PHYBL_185781T0-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000027	0.000000

TMHMM  Annotations     

Start	End
86	108