CAZyme Information: PHYBL_185653T0-p1

Basic Information

• Species: Phycomyces blakesleeanus
• Lineage: Mucoromycota; Mucoromycetes; ; Phycomycetaceae; Phycomyces; Phycomyces blakesleeanus
• CAZyme ID: PHYBL_185653T0-p1
• CAZy Family: GT15
• CAZyme Description: Trehalose-6-phosphate synthase component TPS1 and related subunits

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
913		103896.07	7.2182

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PblakesleeanusNRRL1555	16528	763407	0	16528

• Gene Location: location=PblaNRRL1555-_SC04:2121323-2126701(+)

Full Sequence      

MYVCVGGFVRVCGFVCVWVDLRTWVDLCVCGWILSTRRGTVEQKKIFLVDCRAFLELKRS
DVFSNLKTPGSVAFLALVLIEKNFNSRVATNVTSTMNGNNKVDEYVTLFNSVSKGNMDSK
YYNSVKKSTNKLNSFKSYLPDPPTKKGRIINVTHQVPCEITLRNNVLQDQPMWELTPRRG
HGAMYGGVQSLETDWETIYIGWTGQMYRPSSPEFSSNTTVTNIQTTPIISLDEKEKQSLI
YELQNLNCIPLFLDSDSVFGHYDGYCKTMLWPLFHYIIWDNATDGRLERQQWESFSSVNQ
LYADAVIENYQEGDVVWVHDYHLLLVPAMVRAKLPRARIGLFVHSPFPSSEIFRCLPKRQ
QVLKGMLGANLVGFQTYAYARHFISTCTRVLGYESTPEGVDRGDGHFCHVGTFPIGIDTE
SVDAKFRDPDVIMKVKAITDMYPGKKILVGRDKLDLVKGVLQKLAAFEKFLADYPEWRNK
VVLIQLTDGSTHTMEREVTEIIARINGVYGCIEGAAVYHYHHPVQVDEYYALLSAAHAAL
VTSGRDGMNTTSLEYVMCQQERHGQLILSELMGAAGSMSSALMVNPWDYAGLAKTINDAL
LMSEEEKLYRHKQLLKHVKSHTASFWARSFVKMLMESVELSEKSSHTPLLRTEWLTQCYR
SSTKRLLCFDYEGTLTPLRKMYGLTVPSKSTMDTLEQLCRDPRNEVWIISGRDESTLDYL
LGSIVGLGLSAEHGSFMKYPNTKKWINTTEHLDMSWKHDVVEIFTYYSERTAGSFIEHKR
SSVTWDYRLADPQYGLFQAKECQNHLEQAILSKMPVDVVVGKKNLEVRPTSVNKGQIVKR
LLASNQDLDFVMCCGDDKTDEDMFKAIKKFDVDEQWTFSVKIGTENKKTLALWHLPTTQD
LIHSLNAVVTSNV

Enzyme Prediction     

EC	3.1.3.12:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	145	634	1.1e-160	0.9726315789473684

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
184712	PRK14501	0.0	147	911	1	726	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
215556	PLN03064	0.0	187	864	130	807	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional
340820	GT20_TPS	0.0	148	634	1	462	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
395781	Glyco_transf_20	4.30e-178	147	634	1	468	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
215555	PLN03063	2.25e-173	187	864	47	717	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS13004.1|GT20	0.0	143	912	20	779
CDS06611.1|GT20	1.76e-302	173	911	145	874
AJH76892.1|GT20	5.02e-276	138	906	12	827
CDS09548.1|GT20	4.38e-264	137	866	10	761
CDS07232.1|GT20	2.67e-244	173	909	97	825

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DXF_A	3.96e-124	147	631	31	520	Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314],5DXF_B Structure of Candida albicans trehalose-6-phosphate phosphatase N-terminal domain [Candida albicans SC5314]
6JBI_A	1.71e-110	227	634	49	462	Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBI_B Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBR_A Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_B Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_D Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_F Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_H Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_K Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_M Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_O Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBW_A Structure of Tps1/UDP complex [Pyricularia oryzae 70-15],6JBW_B Structure of Tps1/UDP complex [Pyricularia oryzae 70-15]
5HVM_A	1.73e-107	139	647	4	481	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVM_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
5HVO_A	3.33e-106	216	636	49	476	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_C Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_D Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
5HUT_A	1.24e-105	146	634	3	467	Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUT_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUU_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HUU_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HVL_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314],5HVL_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P78875|TPP1_SCHPO	1.77e-182	147	905	37	809	Trehalose-phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tpp1 PE=1 SV=2
sp|Q54K57|TPSA_DICDI	5.06e-170	147	856	16	690	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] A OS=Dictyostelium discoideum OX=44689 GN=tpsA PE=2 SV=1
sp|P31688|TPS2_YEAST	2.45e-167	143	909	10	847	Trehalose-phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TPS2 PE=1 SV=3
sp|Q9P4D3|TPS2_ZYGRO	2.76e-163	145	909	7	854	Trehalose-phosphatase OS=Zygosaccharomyces rouxii OX=4956 GN=TPS2 PE=1 SV=1
sp|O14145|TPS2_SCHPO	5.54e-162	148	905	16	849	Trehalose-phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tps2 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000044	0.000005

TMHMM  Annotations     

There is no transmembrane helices in PHYBL_185653T0-p1.