CAZyme Information: PHYBL_182782T0-p1

Basic Information

• Species: Phycomyces blakesleeanus
• Lineage: Mucoromycota; Mucoromycetes; ; Phycomycetaceae; Phycomyces; Phycomyces blakesleeanus
• CAZyme ID: PHYBL_182782T0-p1
• CAZy Family: GT1
• CAZyme Description: Predicted glycosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
460	PblaNRRL1555-_SC21|CGC1	53347.08	6.4347

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PblakesleeanusNRRL1555	16528	763407	0	16528

• Gene Location: location=PblaNRRL1555-_SC21:464006-466001(-)

Full Sequence      

MRIDFPSSFSKVAKYLFIGYVFLSVVYTAKHFYSSHSQSPSQDTNGIFPRGPDDKTDFTN
QHPVVVAAGQQQDLLNTPSQQQQQQSSQQQQVSVPWSGGVGDKDVSQSMSEQFLMSKVFS
DAMGPSDLKPYYFKAQKVPEQEDITMATLVTRNRFKVLSRLATHYKGPISAAVHVNDDDT
KEETIEELRALYAVNPDLRDYVDIHLIVDKFDRQFNMWRNVAKFFARTDYIMMLDVDFHL
CTDFRKSIRNNPAIMDKLRAGKTALVVPAFEYLVQDDGLDWRTFPTTKAQLLQEVEEDKI
DMFHKSWLRGHGSTNYTQWYQTPTDSALAQPYKVVDYNFSYEPYIIYKKEGSPWCDERFI
GYGANKAACLYEIYLSGIDYYVLPADFLIHQTHEYPEETRRKERQYNRKLYSNFREELCL
RYSRLFVATGAWDEPLADNLKTECQKIRGFRSTIKGPTEA

Enzyme Prediction     

No EC number prediction in PHYBL_182782T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT49	135	422	1.5e-48	0.8367952522255193

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404735	Glyco_transf_49	9.61e-61	143	422	1	326	Glycosyl-transferase for dystroglycan. This glycosyl-transferase brings about the glycosylation of the alpha-dystroglycan subunit. Dystroglycan is an integral member of the skeletal muscular dystrophin glycoprotein complex, which links dystrophin to proteins in the extracellular matrix.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS09884.1|GT49	3.07e-199	102	454	44	390
CDS10115.1|GT49	1.02e-192	1	458	1	430
CDS06217.1|GT49	9.90e-192	1	454	1	431
CDS06289.1|GT49	8.42e-181	8	454	6	421
CDS14203.1|GT49	1.53e-179	94	454	69	424

PDB Hits     

PHYBL_182782T0-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5XPT3|LARG2_MOUSE	4.41e-25	139	393	398	638	Xylosyl- and glucuronyltransferase LARGE2 OS=Mus musculus OX=10090 GN=Large2 PE=1 SV=1
sp|Q6P7A1|LARG2_RAT	5.90e-25	139	393	397	638	Xylosyl- and glucuronyltransferase LARGE2 OS=Rattus norvegicus OX=10116 GN=Large2 PE=2 SV=1
sp|O95461|LARG1_HUMAN	8.67e-25	132	422	462	742	Xylosyl- and glucuronyltransferase LARGE1 OS=Homo sapiens OX=9606 GN=LARGE1 PE=1 SV=1
sp|Q66PG2|LARG1_DANRE	8.68e-25	132	393	463	709	Xylosyl- and glucuronyltransferase LARGE1 OS=Danio rerio OX=7955 GN=large1 PE=2 SV=1
sp|Q9Z1M7|LARG1_MOUSE	3.73e-24	132	422	462	742	Xylosyl- and glucuronyltransferase LARGE1 OS=Mus musculus OX=10090 GN=Large1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999991	0.000042

TMHMM  Annotations     

There is no transmembrane helices in PHYBL_182782T0-p1.