CAZyme Information: PHYBL_179151T0-p1

Basic Information

• Species: Phycomyces blakesleeanus
• Lineage: Mucoromycota; Mucoromycetes; ; Phycomycetaceae; Phycomyces; Phycomyces blakesleeanus
• CAZyme ID: PHYBL_179151T0-p1
• CAZy Family: GH72
• CAZyme Description: Mannosyl-oligosaccharide alpha-1,2-mannosidase and related glycosyl hydrolases

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
571		64839.31	4.7616

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PblakesleeanusNRRL1555	16528	763407	0	16528

• Gene Location: location=PblaNRRL1555-_SC02:1595127-1597429(-)

Full Sequence      

MRFLEWKSKGTGVLLMLTAVQAFDRSVFQQPMYANKSISNDSYRIRAQSPLPDATQLTQK
EKQDFIKGAFMFAWEGYRAFSWGYDENRPVSNRPVNTRNGWGATIVDALDTLYLMGLTEQ
FNEAKDFVRTIDWKAVKPGNEEVQVFETVIRYVGGLISAYDLSGDSVFITKAVELVDLLM
PAFDTPTGIPYQFVNFKTGKGVKSGFTDGASCLAELGTVQLEFTRLSQITDNWVYHRAGQ
RVYEAFENMRTSPHGLFTHLINPDTGKQLGNYITWGGMADSFYEYLIKQYVMSKGRDERM
KDMSIAAIRSLEKHLLTSPKDHSERVLLSVLDNGVQVPVMDELACFAPGSLLLASKTIPG
LKNIEDFAADLMDGCYIAWSSTRTGLAPETFGWEDSKDGHTVVGELTGRRKQLAEEAGVF
PVTSSYILRPETLESLYYFYKYTGDKSYEIKAWNIFNALHVYSHSSSGFSGVQDIDSSYP
TWDDRQESFFFAETFKYLYLFYDDDAAESVSFDQWVFNTEAHPFRIVDKEPPKPVEVPWF
DEISDFFDKCLSFILGILFGWIGIIYKSIFG

Enzyme Prediction     

EC	3.2.1.113:73

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	69	526	2.6e-144	0.9977578475336323

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	0.0	69	526	1	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	1.32e-155	58	529	68	521	glycoside hydrolase family 47 protein; Provisional
224250	YyaL	0.005	151	262	472	583	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS03956.1|GH47	3.51e-111	62	529	34	486
AMJ52391.1|GH47	1.04e-104	52	524	94	563
CDS05660.1|GH47	3.26e-101	66	526	57	529
AAH76725.1|GH47	4.29e-99	60	527	180	629
BBM97475.1|GH47	9.62e-99	52	542	136	601

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1NXC_A	8.54e-91	58	536	16	474	Structure of mouse Golgi alpha-1,2-mannosidase IA reveals the molecular basis for substrate specificity among Class I enzymes (family 47 glycosidases) [Mus musculus]
5KKB_A	1.31e-90	58	527	18	468	Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus],5KKB_B Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus]
2RI8_A	2.59e-88	58	526	1	473	Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI8_B Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI9_A Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum],2RI9_B Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum]
1KKT_A	6.99e-88	58	526	36	508	Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KKT_B Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KRE_A Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRE_B Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_A Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_B Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum]
5KIJ_A	1.34e-84	62	526	5	451	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12563|MNS1B_ASPPH	2.73e-95	50	526	30	510	Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus phoenicis OX=5063 GN=mns1B PE=2 SV=1
sp|O60476|MA1A2_HUMAN	3.81e-95	60	527	178	627	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB OS=Homo sapiens OX=9606 GN=MAN1A2 PE=1 SV=1
sp|P39098|MA1A2_MOUSE	7.52e-95	53	527	171	627	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB OS=Mus musculus OX=10090 GN=Man1a2 PE=1 SV=1
sp|E9CXX8|MNS1B_COCPS	3.53e-94	9	526	2	514	Mannosyl-oligosaccharide alpha-1,2-mannosidase OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) OX=443226 GN=CPSG_02648 PE=1 SV=1
sp|D4AV26|MNS1B_ARTBC	5.29e-94	57	526	35	507	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase ARB_00035 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_00035 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.167572	0.832406	CS pos: 22-23. Pr: 0.7839

TMHMM  Annotations     

Start	End
551	570