CAZyme Information: PHYBL_178725T0-p1

Basic Information

• Species: Phycomyces blakesleeanus
• Lineage: Mucoromycota; Mucoromycetes; ; Phycomycetaceae; Phycomyces; Phycomyces blakesleeanus
• CAZyme ID: PHYBL_178725T0-p1
• CAZy Family: GH63
• CAZyme Description: Protein phosphatase, regulatory subunit PPP1R3C/D

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
427		48200.23	9.5641

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PblakesleeanusNRRL1555	16528	763407	0	16528

• Gene Location: location=PblaNRRL1555-_SC01:1459692-1460975(-)

Full Sequence      

MAHSAVFTRHESHTWKRITLKRSPVLITHSATSTSTSTCSLPSSPLKPPISQAPRIEAAS
QRPCLRTRLSSSSSSLSSLSSLRSKSVRFDPELEKICLFQKSHAPSTLKEDNETLCAKAK
QESLGIVYMHWPARSTQHTSRPIRVEKKLDVTTTEIVGQVQVRNLAYHKTVWVRYTFDCW
QTVENVEAVYREPVGGKDPNNSNYDIFIFTIQLNRLSTNRPANNNVLATLDFAVQYTVDG
REVWDNNEGKNYSVQLIKSVDDSEDKTRDRYRDRDSLVTPAKLPAANSRSRSMVQVTRED
EEEEDNLWGPRYDFGNSITQARRNPPVEIPKVHSPMIRSIPTAKTTEPFKQPYSRPVPIP
QRQPRASILYASSPPNAAFYHGFPIVSFNPSSPTSCVDLNSSSYMDLVNKYCFYGTSPTR
SPMPING

Enzyme Prediction     

No EC number prediction in PHYBL_178725T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM21	150	254	1.9e-27	0.8785046728971962

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397445	CBM_21	4.20e-33	142	255	6	113	Carbohydrate/starch-binding module (family 21). This family consists of several eukaryotic proteins that are thought to be involved in the regulation of glycogen metabolism. For instance, the mouse PTG protein has been shown to interact with glycogen synthase, phosphorylase kinase, phosphorylase a: these three enzymes have key roles in the regulation of glycogen metabolism. PTG also binds the catalytic subunit of protein phosphatase 1 (PP1C) and localizes it to glycogen. Subsets of similar interactions have been observed with several other members of this family, such as the yeast PIG1, PIG2, GAC1 and GIP2 proteins. While the precise function of these proteins is not known, they may serve a scaffold function, bringing together the key enzymes in glycogen metabolism. This family is a carbohydrate binding domain.
407028	CBM53	1.11e-12	164	254	1	75	Starch/carbohydrate-binding module (family 53).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS02860.1|CBM21	1.71e-21	85	323	65	303
QKX59775.1|CBM21	1.91e-21	62	424	205	578
CAP80870.1|CBM21	3.40e-21	62	418	235	626
CDS05148.1|CBM21	2.47e-20	69	415	68	374
QGA19725.1|CBM21	4.44e-20	62	416	238	599

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2EEF_A	2.15e-11	156	254	48	135	Chain A, Protein phosphatase 1, regulatory (Inhibitor) subunit 3B [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|T1SFR8|PPR3C_CLABA	2.65e-12	156	269	153	253	Protein phosphatase 1 regulatory subunit 3C OS=Clarias batrachus OX=59899 GN=PPP1R3C PE=2 SV=1
sp|Q7TMB3|PPR3C_MOUSE	3.61e-12	131	258	138	260	Protein phosphatase 1 regulatory subunit 3C OS=Mus musculus OX=10090 GN=Ppp1r3c PE=1 SV=1
sp|Q5U2R5|PPR3C_RAT	8.74e-12	156	258	169	260	Protein phosphatase 1 regulatory subunit 3C OS=Rattus norvegicus OX=10116 GN=Ppp1r3c PE=2 SV=1
sp|P40187|PIG2_YEAST	1.54e-11	156	257	408	510	GSY2-interacting protein PIG2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PIG2 PE=1 SV=1
sp|Q0VCR4|PPR3C_BOVIN	2.85e-11	156	258	169	260	Protein phosphatase 1 regulatory subunit 3C OS=Bos taurus OX=9913 GN=PPP1R3C PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000059	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PHYBL_178725T0-p1.