CAZyme Information: PHYBL_158715T0-p1

Basic Information

• Species: Phycomyces blakesleeanus
• Lineage: Mucoromycota; Mucoromycetes; ; Phycomycetaceae; Phycomyces; Phycomyces blakesleeanus
• CAZyme ID: PHYBL_158715T0-p1
• CAZy Family: GH37
• CAZyme Description: Fucosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
420	PblaNRRL1555-_SC09|CGC2	48101.42	4.7668

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PblakesleeanusNRRL1555	16528	763407	0	16528

• Gene Location: location=PblaNRRL1555-_SC09:1315782-1317320(-)

Full Sequence      

MFDGNDKNIGDECPVPEGFVFNISSGEPWCTITPDLNNPEDASALLFHAADYAPSQVPRR
IDNQPWILETQESPITASFRTNEGLMEPFDFLASYHLKSDFLFTYFSPYVYEVANRPLPD
DFMKKKTTRAPILWIAKNCYATSGRQTYVAELMKYIKVDSYGPCLNNMEFTENLTRTDLM
AEYKFYLAIENANCDDYVTEKLFDTLVLSTVPIVDGPDSYDSFLPNSKAGIRMDKYPDPR
DLAAYIDYLDKNDTAYLEHLSHQRDAQTLPAKERLSPAFIDNWRDYGLHTNRSDWCSVCR
GVAPIWRGRVEPYYTYVPAVERKDRFLIDRSCNKPGKWDYASSGPPYIAPWAQVPHEGVD
SVQLGGDSTHGEVVGDQVWSILSIWKLEIVICVLFLSFIASMLYKRHMFICLQQRSSLPK

Enzyme Prediction     

EC	2.4.1.152:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT10	27	302	4.9e-67	0.7694524495677233

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395683	Glyco_transf_10	3.44e-43	124	300	1	157	Glycosyltransferase family 10 (fucosyltransferase) C-term. This is the C-terminal domain of a family of fucosyltransferases. This enzyme transfers fucose from GDP-Fucose to GlcNAc in an alpha1,3 linkage. This family is known as glycosyltransferase family 10. The C-terminal domain is the likely binding-region for ADP (manuscript in publication).
407214	Glyco_tran_10_N	2.52e-06	26	105	27	108	Fucosyltransferase, N-terminal. This is the N-terminal domain of a family of fucosyltransferases. This enzyme transfers fucose from GDP-Fucose to GlcNAc in an alpha1,3 linkage. This family is known as glycosyltransferase family 10. The N-terminal domain is the likely binding-region for the fucose-like substrate (manuscript in publication).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS03884.1|GT10	1.18e-106	70	407	2	337
CDS13017.1|GT10	3.04e-95	1	197	22	216
AFO96721.1|GT10	2.40e-34	60	264	6	226
UJR23117.1|GT10	2.45e-34	40	333	110	431
CAE54304.1|GT10	8.24e-34	43	274	125	377

PDB Hits     

PHYBL_158715T0-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q70AG8|FUT11_TAKRU	1.46e-34	43	274	125	377	Alpha-(1,3)-fucosyltransferase 11 OS=Takifugu rubripes OX=31033 GN=fut11 PE=2 SV=1
sp|Q8AWC7|FUT11_CHICK	7.50e-34	44	263	131	366	Alpha-(1,3)-fucosyltransferase 11 OS=Gallus gallus OX=9031 GN=FUT11 PE=2 SV=1
sp|Q8BHC9|FUT11_MOUSE	8.51e-34	44	264	115	351	Alpha-(1,3)-fucosyltransferase 11 OS=Mus musculus OX=10090 GN=Fut11 PE=1 SV=1
sp|Q495W5|FUT11_HUMAN	8.83e-34	44	264	119	355	Alpha-(1,3)-fucosyltransferase 11 OS=Homo sapiens OX=9606 GN=FUT11 PE=1 SV=1
sp|Q5F2N2|FUT11_ORYLA	9.38e-34	43	260	121	354	Alpha-(1,3)-fucosyltransferase 11 OS=Oryzias latipes OX=8090 GN=fut11 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000055	0.000001

TMHMM  Annotations     

Start	End
378	400