CAZyme Information: PHYBL_157558T0-p1

Basic Information

• Species: Phycomyces blakesleeanus
• Lineage: Mucoromycota; Mucoromycetes; ; Phycomycetaceae; Phycomyces; Phycomyces blakesleeanus
• CAZyme ID: PHYBL_157558T0-p1
• CAZy Family: GH37
• CAZyme Description: Acetylglucosaminyltransferase EXT1/exostosin 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
418		49379.40	6.6139

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PblakesleeanusNRRL1555	16528	763407	0	16528

• Gene Location: location=PblaNRRL1555-_SC03:1134917-1136173(-)

Full Sequence      

MPTVLRLNKQWIAALVIITLILVSSFFFSGRQAQPPAIPLPIVEIESYWPSPVERAVCKP
KIYVYEASKDFQVPESVQDGRCDESNYNSEIILHRQLTDPNSNINKLYVTKNPEEATFFY
IPFFGSCYLYNCWSKNEWKWTERCDVDELYVDPMMNMVINEYPYWNKTQGRTHIMVHPMD
QTFTYYKHNELFQPAVFLKTVGDKRRKWMHRHRYHRDIVIPSATRLIHHLRYNPEDYVTT
EGHPKTGTRTIFALFQGCCTTVGPEDEYSNGIRSLFHKTFAKYPGYEIGDVITDLEYADK
LAHAKYGLSPMGWTLDTTRIWEFMAFGVVPVVIADGIIEPFEFDVDWDSFVVRVRRDEVH
RLDEILRGIDDKTYEYKRRKLWEYGRRVGLEMDAWHFIVRELCRIQGINQPENLQLGY

Enzyme Prediction     

EC	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT47	59	369	9.9e-48	0.9864864864864865

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397245	Exostosin	1.09e-33	59	369	4	290	Exostosin family. The EXT family is a family of tumor suppressor genes. Mutations of EXT1 on 8q24.1, EXT2 on 11p11-13, and EXT3 on 19p have been associated with the autosomal dominant disorder known as hereditary multiple exostoses (HME). This is the most common known skeletal dysplasia. The chromosomal locations of other EXT genes suggest association with other forms of neoplasia. EXT1 and EXT2 have both been shown to encode a heparan sulphate polymerase with both D-glucuronyl (GlcA) and N-acetyl-D-glucosaminoglycan (GlcNAC) transferase activities. The nature of the defect in heparan sulphate biosynthesis in HME is unclear.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS02760.1|GT47	1.05e-241	1	418	1	417
CDR42542.1|GT47	2.59e-86	39	406	83	536
CDR42535.1|GT47	7.74e-59	138	406	64	411
QDZ20735.1|GT47	1.19e-36	61	402	125	455
UPQ99947.1|GT47	1.19e-36	61	402	125	455

PDB Hits     

PHYBL_157558T0-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q33AH8|GT101_ORYSJ	2.71e-28	57	404	48	387	Probable glucuronosyltransferase GUT1 OS=Oryza sativa subsp. japonica OX=39947 GN=GUT1 PE=2 SV=2
sp|Q8S1X7|GT15_ORYSJ	3.71e-28	9	404	2	387	Probable glucuronosyltransferase Os01g0926700 OS=Oryza sativa subsp. japonica OX=39947 GN=Os01g0926700 PE=3 SV=1
sp|Q8S1X8|GT14_ORYSJ	6.79e-28	61	404	50	385	Probable glucuronosyltransferase Os01g0926600 OS=Oryza sativa subsp. japonica OX=39947 GN=Os01g0926600 PE=2 SV=1
sp|Q9FZJ1|IRX10_ARATH	1.23e-27	57	404	43	382	Probable beta-1,4-xylosyltransferase IRX10 OS=Arabidopsis thaliana OX=3702 GN=IRX10 PE=2 SV=1
sp|Q940Q8|IX10L_ARATH	1.15e-26	61	404	50	385	Probable beta-1,4-xylosyltransferase IRX10L OS=Arabidopsis thaliana OX=3702 GN=IRX10L PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999243	0.000795

TMHMM  Annotations     

Start	End
12	29