CAZyme Information: PHYBL_153504T0-p1

Basic Information

• Species: Phycomyces blakesleeanus
• Lineage: Mucoromycota; Mucoromycetes; ; Phycomycetaceae; Phycomyces; Phycomyces blakesleeanus
• CAZyme ID: PHYBL_153504T0-p1
• CAZy Family: GT8
• CAZyme Description: UDP-glucuronosyl and UDP-glucosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
555	PblaNRRL1555-_SC45|CGC1	62725.47	9.5856

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PblakesleeanusNRRL1555	16528	763407	0	16528

• Gene Location: location=PblaNRRL1555-_SC45:185905-187914(+)

Full Sequence      

MKWPIIFNFLLFILLSFIVPTRSIDNPNPNTLELVEDFRVSKNIVFSCQAGGSSHINWVL
LILEELATRGHNITYITRDDHLKFGKPYPKIKSVSIGKRLVQSWLPTTSGKRGDWIERMK
VVEGPIRSETEKEVAFYRSYFTENNVDVALCDMFTTICVLVAREMKIPFIITSSIDISPD
SKAPYINNGIMDMEDPITLYQSYFKRLYTTTILPYTTIYRTMGYAKEFSRKLDSVGISGF
NGNEIGLWKDSLKMVNTVFGFEPARPVGPLVEFVGPIIPRNHQPLTDSLKSYLDTHQRIA
YIAFGQHATPELHDTRLILTAMFENIENGALDGFVWATVHLTKDFPTSITTSSNTTYYYS
DLIKDKIPSSRLVRWAPQYAVLNHPSTIMFMTHGGAGSLHEALFAGKRLVGYPFCGDQPG
TARNIERSKLGAFVDYKKSQLEANKAIERVVRDKGGVIQQTVNRYKALVQIHTQTGVRRG
ADLVEEVAFVNVDGALPHRYEVARKMSFVKANNLDVHATWILAVLGLFYLIVLGVKSAIL
SIYTSVHRSRKLKTL

Enzyme Prediction     

No EC number prediction in PHYBL_153504T0-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340817	GT1_Gtf-like	3.12e-32	43	454	2	376	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
278624	UDPGT	2.94e-20	62	532	19	482	UDP-glucoronosyl and UDP-glucosyl transferase.
273616	MGT	1.36e-19	50	485	3	387	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
224732	YjiC	1.40e-13	44	488	5	399	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
223071	egt	1.93e-13	252	453	248	432	ecdysteroid UDP-glucosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOC55050.1|GT1	2.39e-131	30	526	26	522
AOC55049.1|GT1	6.88e-113	10	537	8	531
CDS06902.1|GT1	5.20e-101	23	533	20	526
CDS06891.1|GT1	4.98e-99	42	532	46	528
CDS11218.1|GT1	8.97e-95	40	535	40	527

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2O6L_A	2.96e-11	369	453	69	154	Crystal Structure of the UDP-Glucuronic Acid Binding Domain of the Human Drug Metabolizing UDP-Glucuronosyltransferase 2B7 [Homo sapiens],2O6L_B Crystal Structure of the UDP-Glucuronic Acid Binding Domain of the Human Drug Metabolizing UDP-Glucuronosyltransferase 2B7 [Homo sapiens]
3HBF_A	7.37e-11	292	466	266	428	Structure of UGT78G1 complexed with myricetin and UDP [Medicago truncatula],3HBJ_A Structure of UGT78G1 complexed with UDP [Medicago truncatula]
7CJX_A	3.67e-09	369	453	70	155	Chain A, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_B Chain B, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_C Chain C, UDP-glucuronosyltransferase 2B15 [Homo sapiens],7CJX_D Chain D, UDP-glucuronosyltransferase 2B15 [Homo sapiens]
6IPB_A	5.72e-09	369	453	91	176	Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_B Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_C Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens],6IPB_D Crystal Structure of the Cofactor-binding Domain of the Human Phase II Drug Metabolism Enzyme UGT2B15 [Homo sapiens]
2PQ6_A	9.27e-09	334	476	316	463	Crystal structure of Medicago truncatula UGT85H2- Insights into the structural basis of a multifunctional (Iso) flavonoid glycosyltransferase [Medicago truncatula]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q80X89|UD2A1_MOUSE	2.40e-14	52	516	30	492	UDP-glucuronosyltransferase 2A1 OS=Mus musculus OX=10090 GN=Ugt2a1 PE=2 SV=1
sp|P06133|UD2B4_HUMAN	3.19e-14	54	516	34	493	UDP-glucuronosyltransferase 2B4 OS=Homo sapiens OX=9606 GN=UGT2B4 PE=1 SV=2
sp|Q3UP75|UD3A1_MOUSE	7.33e-14	247	443	241	419	UDP-glucuronosyltransferase 3A1 OS=Mus musculus OX=10090 GN=Ugt3a1 PE=1 SV=1
sp|P36514|UD2C1_RABIT	9.17e-14	57	435	8	387	UDP-glucuronosyltransferase 2C1 (Fragment) OS=Oryctolagus cuniculus OX=9986 GN=UGT2C1 PE=2 SV=1
sp|Q8JZZ0|UD3A2_MOUSE	9.72e-14	247	454	241	431	UDP-glucuronosyltransferase 3A2 OS=Mus musculus OX=10090 GN=Ugt3a2 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000203	0.999793	CS pos: 23-24. Pr: 0.9748

TMHMM  Annotations     

Start	End
5	24
518	540