CAZyme Information: PHYBL_139610T0-p1

Basic Information

• Species: Phycomyces blakesleeanus
• Lineage: Mucoromycota; Mucoromycetes; ; Phycomycetaceae; Phycomyces; Phycomyces blakesleeanus
• CAZyme ID: PHYBL_139610T0-p1
• CAZy Family: GH18
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
330		36620.34	9.5217

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PblakesleeanusNRRL1555	16528	763407	0	16528

• Gene Location: location=PblaNRRL1555-_SC02:1607920-1609000(+)

Full Sequence      

MRLSFNLTILAISFFISIASAIESVTVCSICKYKTVSSALASLPSDNSTWTIRVTPGIYT
EQVKIYRSNVILRPTILGHVLIRYNGWRDTQTPTGTNDGSATLSIYGTNVKIYNMIIANI
YPQTRNIANLALNVQAKKASFYNVKFYGFQDTVYIGLNTTSYFKNCYIEGSVDYVYGEGT
ATNRPSSFITAQKRATASSEGGFYFNKCHIIPTLPSGPLVTTYNSTISFTSSSQFSQSTY
LGRPWSKYARVIYMYSNFGINVKSAGWSQWSDASPNTSDVLFGEYKNSGPGLWNATARAS
FATLLTDSEAELYSLTNIFKSTSWIDKLHN

Enzyme Prediction     

No EC number prediction in PHYBL_139610T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	31	319	5.3e-63	0.9583333333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215357	PLN02665	5.08e-44	33	325	80	360	pectinesterase family protein
178372	PLN02773	1.31e-39	33	326	17	297	pectinesterase
215367	PLN02682	5.28e-39	33	326	82	362	pectinesterase family protein
178051	PLN02432	5.37e-37	33	325	23	292	putative pectinesterase
395871	Pectinesterase	4.04e-36	31	317	10	293	Pectinesterase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQK47705.1|CE8	1.04e-57	33	326	91	382
CEI63109.1|CE8	5.73e-52	32	326	1139	1434
QPC71811.1|CE8	1.05e-51	32	326	1065	1360
QPC60527.1|CE8	1.05e-51	32	326	1066	1361
CCT74155.1|CE8	6.65e-51	32	326	1106	1400

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1E_A	3.95e-28	33	291	19	265	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	2.04e-27	33	291	19	265	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
1GQ8_A	2.01e-25	33	325	19	308	Pectin methylesterase from Carrot [Daucus carota]
1XG2_A	1.33e-19	33	325	15	304	Chain A, Pectinesterase 1 [Solanum lycopersicum]
2NSP_A	3.42e-15	33	318	18	333	Chain A, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B2VPR8|AL11B_OLEEU	1.28e-29	33	325	77	355	Pectinesterase 2 OS=Olea europaea OX=4146 PE=1 SV=1
sp|Q84WM7|PPME1_ARATH	6.23e-29	32	325	75	355	Pectinesterase PPME1 OS=Arabidopsis thaliana OX=3702 GN=PPME1 PE=1 SV=1
sp|Q12535|PME_ASPAC	7.16e-29	33	326	37	327	Pectinesterase OS=Aspergillus aculeatus OX=5053 GN=pme1 PE=2 SV=1
sp|Q9LVQ0|PME31_ARATH	1.07e-28	33	310	17	287	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
sp|D8VPP5|AL11A_OLEEU	1.25e-28	33	325	77	355	Pectinesterase 1 OS=Olea europaea OX=4146 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000292	0.999680	CS pos: 21-22. Pr: 0.9774

TMHMM  Annotations     

There is no transmembrane helices in PHYBL_139610T0-p1.