CAZyme Information: PHYBL_134099T0-p1

Basic Information

• Species: Phycomyces blakesleeanus
• Lineage: Mucoromycota; Mucoromycetes; ; Phycomycetaceae; Phycomyces; Phycomyces blakesleeanus
• CAZyme ID: PHYBL_134099T0-p1
• CAZy Family: GH17
• CAZyme Description: Dolichyl-phosphate-mannose:protein O-mannosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
763	PblaNRRL1555-_SC12|CGC1	87331.70	6.5349

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PblakesleeanusNRRL1555	16528	763407	0	16528

• Gene Location: location=PblaNRRL1555-_SC12:1023696-1026700(+)

Full Sequence      

MTDPALRKRRNYDENSLQNGSGINVDDYTDDTKKVNVSNLSPSKYSHLIGLSIVTIAGFF
VTFYKIWYPAEVVFDEVHFGKFAGYYLRRTYFFDVHPPLAKMMLAAVGYMVGYDGHFEFD
NIGDSYIENNVPYIALRALPASLNVFCIALMYSIMKESGYSVCTCFLTASLYLLDNAIVA
QHRLIMLDSMLIFFMLATVYSYIRFRKVRHQEFSATWWAWLLATGVTMALTLSVKMVGLF
LVAAIGICVIVDLWDLLDIKRGISIDHFIKHFYARALGLIAVPAFIYMFWFYVHFAILVE
SGPGDTFMSSAFQETLKNSAIKMKSLDIHYNDDIRLMHKDTEKYLHSHDLEYPLRYDDGR
ISSQGQQVTAITVPDDNSWWRIKPTKEISEDEPVPIIHGDIVQLEHVGTETILLTHDVAS
PLMSTNEEVTTVDLDERYNETLFQVLFDDHNNGDIWQTYMKAVRLVHMDTKVAIWTHPKN
LPDWGLGHQEVNGNKNLMDKSNYWVATEIDGLNATEINLEKKKEIKTIPFIFKFVELLGR
MLSHNSGLTKPHPYQSNAISWPLLSRGISYWSKDDTKEQIYMTGNVFGWYLSMVGTIIYT
GAIIIDTICRRRDVAWIEEPLRRRLIQSAGFFILLWLLHYIPFFAMGRALFLHHYLPAAA
CNYLLLGAVFQYLFITSVDSPTSDLRRNQSALEEIHPVGPAHAQTSTQAQPTTKTYIIAT
IILALQFACFVFLSPLTYGSPGLSIDEVQRRKVFSGWDLQFAK

Enzyme Prediction     

EC	2.4.1.109:8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	54	295	5.7e-66	0.9910313901345291

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224839	PMT1	0.0	31	763	6	699	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
396786	PMT	9.12e-82	52	298	1	244	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
406576	PMT_4TMC	1.32e-59	533	755	2	198	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
197746	MIR	2.84e-11	327	384	3	56	Domain in ryanodine and inositol trisphosphate receptors and protein O-mannosyltransferases.
397103	MIR	3.04e-08	336	505	3	184	MIR domain. The MIR (protein mannosyltransferase, IP3R and RyR) domain is a domain that may have a ligand transferase function.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS13311.1|GT39	0.0	1	763	1	759
QRW16888.1|GT39	8.20e-236	43	762	59	773
QRW02771.1|GT39	8.20e-236	43	762	59	773
QRV73816.1|GT39	8.20e-236	43	762	59	773
ALJ52589.1|GT39	1.53e-233	5	763	10	765

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P25_B	3.37e-86	5	759	22	753	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_B Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
6P25_A	2.49e-79	68	758	70	728	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_A Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
3MAL_A	1.27e-13	324	508	14	188	Crystal structure of the SDF2-like protein from Arabidopsis thaliana [Arabidopsis thaliana],3MAL_B Crystal structure of the SDF2-like protein from Arabidopsis thaliana [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P46971|PMT4_YEAST	7.29e-195	43	763	50	762	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMT4 PE=1 SV=1
sp|Q59X23|PMT4_CANAL	1.65e-194	8	752	6	745	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PMT4 PE=2 SV=2
sp|O42933|PMT4_SCHPO	1.37e-190	29	763	42	776	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ogm4 PE=3 SV=1
sp|Q99PR0|POMT1_RAT	2.07e-111	49	763	39	746	Protein O-mannosyl-transferase 1 OS=Rattus norvegicus OX=10116 GN=Pomt1 PE=2 SV=1
sp|Q8R2R1|POMT1_MOUSE	1.22e-108	49	763	37	746	Protein O-mannosyl-transferase 1 OS=Mus musculus OX=10090 GN=Pomt1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999954	0.000037

TMHMM  Annotations     

Start	End
48	70
90	112
133	155
184	203
215	234
238	257
277	299
586	608
629	651
656	678
716	738