CAZyme Information: PHYBL_133446T0-p1

Basic Information

• Species: Phycomyces blakesleeanus
• Lineage: Mucoromycota; Mucoromycetes; ; Phycomycetaceae; Phycomyces; Phycomyces blakesleeanus
• CAZyme ID: PHYBL_133446T0-p1
• CAZy Family: GH16
• CAZyme Description: Maltase glucoamylase and related hydrolases, glycosyl hydrolase family 31

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
625		71029.06	6.1493

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PblakesleeanusNRRL1555	16528	763407	0	16528

• Gene Location: location=PblaNRRL1555-_SC10:116347-118720(+)

Full Sequence      

MLDHNRVLLTYASRKEEEFYGFGEQFSYTSFKGKKVPIFVREQGIGRGDQPITALLNSPL
SVFGEFAGGDHFTTYASVPQYITTDNRCLFLETSEYASFDLKQPDRVIVRLNSNTMIGRI
VDGESMLELITEYTLYSGRMNVLPDWISEGAVAGMQGGASKVRDVVKRLQDHDTPLAAVW
LQDWCGKRIQQTGNGSSFKRLWWNWESDDGLYPHWKDFVQEMLNQEKGPVRVLSYVNPFL
ANVEHKEGAHRNLFLEAQNKGYLVKDPSRPSECKTLIISSGPDFEAGLLDITYPEARIWF
KQVLKEQVWGTGVSGMMTDFGEYLPYSSEKASLHSGIAPEVYHNRYPEDWASLHHEVVTE
LGLQNEAVNFYRAAYTRSPAYINLMWAGDQNVTWDQNDGIKSAVIGMLSGGFSGFSITHS
DIGGYTTLNGLLPGLNITRSKDLLHRWMELAAFTAVFRTHEGIIPESNAQFYDSEDSYVQ
FAHMAKLFKSLSPYRKHLIREANEKGWPLMRHLVLYYPNDPTVRDLTYQQFLLGSALLVA
PTLSPSATFVKVYFPQEHTKGIFWRHIWTGKYYPADGKYVAVDTPYGLPAAFVKEPREDD
GLLNTLLEFSSDHYNHHQINQQSGN

Enzyme Prediction     

No EC number prediction in PHYBL_133446T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	121	595	5.9e-81	0.9812646370023419

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
236691	PRK10426	0.0	2	609	67	633	alpha-glucosidase; Provisional
269880	GH31_glucosidase_YihQ	8.14e-180	138	485	1	325	alpha-glucosidase YihQ-like. YihQ is a bacterial alpha-glucosidase with a conserved glycosyl hydrolase family 31 (GH31) domain that catalyzes the release of an alpha-glucosyl residue from the non-reducing end of alpha-glucoside substrates such as alpha-glucosyl fluoride. Orthologs of YihQ that have not yet been functionally characterized are present in plants and fungi. YihQ has sequence similarity to other GH31 enzymes such as CtsZ, a 6-alpha-glucosyltransferase from Bacillus globisporus, and YicI, an alpha-xylosidase from Echerichia coli. These latter two belong to different GH31 subfamilies than YihQ. In bacteria, YihQ (along with YihO) is important for bacterial O-antigen capsule assembly and translocation.
224418	YicI	9.51e-82	16	595	134	666	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
395838	Glyco_hydro_31	1.06e-54	123	595	5	438	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
269878	GH31_NET37	8.07e-42	160	555	18	360	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS13477.1|GH31	1.63e-266	1	611	156	759
QIN82013.1|GH31	1.88e-182	4	595	158	722
BCS07610.1|GH31	1.29e-178	6	609	156	757
BCR95040.1|GH31	1.29e-178	6	609	156	757
CAK39259.1|GH31	2.05e-177	5	609	155	757

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6PNR_A	2.98e-117	5	608	100	663	Chain A, Alpha-glucosidase [[Eubacterium] rectale],6PNR_C Chain C, Alpha-glucosidase [[Eubacterium] rectale]
5AED_A	1.81e-114	2	606	112	675	A bacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12],5AED_B A bacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12],5AEG_A A bacterial protein structure in glycoside hydrolase family 31. [Escherichia coli K-12],5AEG_B A bacterial protein structure in glycoside hydrolase family 31. [Escherichia coli K-12],5OHT_A A GH31 family sulfoquinovosidase from E. coli in complex with aza-sugar inhibitor IFGSQ [Escherichia coli K-12],5OHT_B A GH31 family sulfoquinovosidase from E. coli in complex with aza-sugar inhibitor IFGSQ [Escherichia coli K-12]
5AEE_A	9.96e-114	2	606	112	675	A bacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12],5AEE_B A bacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12]
5OHY_A	2.99e-103	5	613	98	667	Chain A, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHY_B Chain B, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHY_C Chain C, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHY_D Chain D, Alpha-glucosidase yihQ [Agrobacterium tumefaciens]
5OHS_A	1.63e-102	5	613	98	667	Chain A, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_B Chain B, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_C Chain C, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_D Chain D, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_E Chain E, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_F Chain F, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_G Chain G, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_H Chain H, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],7OFX_A Chain A, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],7OFX_B Chain B, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],7OFX_C Chain C, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],7OFX_D Chain D, Alpha-glucosidase yihQ [Agrobacterium tumefaciens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P32138|SQASE_ECOLI	7.54e-114	2	606	112	675	Sulfoquinovosidase OS=Escherichia coli (strain K12) OX=83333 GN=yihQ PE=1 SV=3
sp|P31434|XYLS_ECOLI	1.68e-25	34	568	152	639	Alpha-xylosidase OS=Escherichia coli (strain K12) OX=83333 GN=yicI PE=1 SV=2
sp|Q9F234|AGL2_BACTQ	7.21e-20	17	595	147	670	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1
sp|Q8TET4|GANC_HUMAN	1.13e-16	162	558	378	742	Neutral alpha-glucosidase C OS=Homo sapiens OX=9606 GN=GANC PE=2 SV=3
sp|Q9FN05|PSL5_ARATH	4.54e-16	162	599	379	783	Probable glucan 1,3-alpha-glucosidase OS=Arabidopsis thaliana OX=3702 GN=PSL5 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000032	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PHYBL_133446T0-p1.