CAZyme Information: PHYBL_127894T0-p1

Basic Information

• Species: Phycomyces blakesleeanus
• Lineage: Mucoromycota; Mucoromycetes; ; Phycomycetaceae; Phycomyces; Phycomyces blakesleeanus
• CAZyme ID: PHYBL_127894T0-p1
• CAZy Family: GH15
• CAZyme Description: Predicted endo-1,3-beta-glucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
599	PblaNRRL1555-_SC27|CGC2	67863.87	7.2140

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PblakesleeanusNRRL1555	16528	763407	0	16528

• Gene Location: location=PblaNRRL1555-_SC27:332055-334407(+)

Full Sequence      

MAYVTGNYVGLTPQFYTQHAIISVHSESTPGADMYSGRKFKIMFNDNPTSTYLIYVLGEK
PLTLQKVGMNNLIASEPYSGIIRIAKLPSPEHETLLDNQHDVWATGGELVASSDGSSATY
SIKWKVVGNPQRTLLTYAYPHHINSFAGDIQKTGMHLESSTKGMMTAVLGDVWTLNENHL
SNVTWLPLNPIPEASTRNEIMRTIELDIHSNYAAETQKGDNYFSGKGLQKFAMLALILNK
PKETFLHNPELAKISLEKIKAAFTPYLENKQEDPYKYDVVYKGIVAKDGLPRIMGGTGNP
DAEFGHTYYNDHHYHQGYLVVTAAIIHHLDPKWRAPELVRWTETLIRDVNCPVEDDPYFA
PFRNWDWFAGHSWAGGIKNNGALDGRDQESVPESVNFYWGTKLWGLATKNSAMIHLAALQ
LAITKRTTYEYFWLLDNNRNRPAEMIKNKLVGIFFEQKTDYTTYFGRYLEFIHGIQQLPM
TPALADDIRIPAFVEEEWNQRLSAVAPQIESPWAGVLWLNYALINPSDAYPRLRTTEVDD
GQTRSYSLYLTATRPDFRRRPLSRVHSKNPKNETAVGGYKPAIRGVRHISFKDAVTFGS

Enzyme Prediction     

No EC number prediction in PHYBL_127894T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	1	549	3.2e-144	0.819935691318328

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407548	Glyco_hydro81C	5.70e-134	194	548	4	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
227785	Acf2	6.33e-125	1	552	201	753	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
397619	Glyco_hydro_81	5.90e-47	1	190	127	321	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS06153.1|GH81	9.02e-281	1	559	177	734
AGV00786.1|GH81	5.03e-275	1	562	186	751
UJR31943.1|GH81	2.97e-119	1	577	182	735
AIG56018.1|GH81	1.35e-98	1	553	208	754
QSS66079.1|GH81	4.32e-97	1	552	288	846

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	7.32e-277	1	562	161	726	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	1.74e-276	1	562	186	751	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	9.80e-270	2	562	162	726	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	5.73e-19	159	569	282	679	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	4.25e-18	67	540	207	664	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09850|ENG2_SCHPO	6.26e-92	1	552	149	700	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|P53753|ENG1_YEAST	2.88e-84	51	548	595	1106	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	6.28e-84	1	552	191	735	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|D4AZ24|ENG1_ARTBC	6.99e-83	1	552	346	900	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q5AIR7|ENG1_CANAL	1.47e-76	1	552	578	1139	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000084	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PHYBL_127894T0-p1.