CAZyme Information: PHYBL_126725T0-p1

Basic Information

• Species: Phycomyces blakesleeanus
• Lineage: Mucoromycota; Mucoromycetes; ; Phycomycetaceae; Phycomyces; Phycomyces blakesleeanus
• CAZyme ID: PHYBL_126725T0-p1
• CAZy Family: GH125
• CAZyme Description: Glucosidase II catalytic (alpha) subunit and related enzymes, glycosyl hydrolase family 31

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
678		77379.00	4.9245

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PblakesleeanusNRRL1555	16528	763407	0	16528

• Gene Location: location=PblaNRRL1555-_SC20:369137-371365(-)

Full Sequence      

MDCMGYDARTQDPLYKFCPFYITLGAQSNAAHGIYYNNFSDTTIDLGQEIDAMWGPYSYY
QAASGPLDYYRVYGPTVSKVVKSYGGLMGRPRHLPPRYAFGYLASSMGYAEAENAQEQLE
AFADLCKEHSIPCDGMHLSSGYTVNANGDRCVFTWNPTRFPDPKRLAAHLKSAGIRIFAN
VKPWLLKSHPDYTLLKVSHGLVWNSDVNDPATLWQWSAGKHTAGEASYIDFTSLVGYRYW
QERLKTRLLDLGYELWLDNNEFTLLDDSNTYACEMHPTVYQPHGLSLPAMSPRDSSARQV
GTPYQTLMMMQASYEAVRKHAPIDRPFIITRSATPFSHQLMSQTWSGDNTTDWSTIEYNI
PMGLGAGLSIMPGGYGHDVGGFAGPRPSPEMFVRWVQQAIFWPRFCIHSWNTDGTITEPW
MYPEVLPLIRASIELRYRLIPYLYSLHIKYFHHECEPVIRPLFYDHQDDPNTHTQSFEFM
VGSNLLIAPVTQPDQISRTVYLPANTSWYHYQTNTYYDVPKEGLTVTVPSLIEDTSSPLF
VKAGTILCFGKVMSSVFADVDDERRIQVFPHPTDTTRTEFHLFEDDGKTIYYENGAYADV
VIWMEPSATEIRVGIEVLEDGYFPNYDTLWVTCPLQDETRPLVFDGEDDLGRSMGLVDQQ
DTNVYEGFRISWKRTQEE

Enzyme Prediction     

No EC number prediction in PHYBL_126725T0-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	69	547	1.9e-108	0.9976580796252927

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
269885	GH31_glycosidase_Aec37	2.29e-158	89	433	1	319	E.coli Aec37-like. Glycosyl hydrolase family 31 (GH31) domain of a bacterial protein family represented by Escherichia coli protein Aec37. The gene encoding Aec37 (aec-37) is located within a genomic island (AGI-3) isolated from the extraintestinal avian pathogenic Escherichia coli strain BEN2908. The function of Aec37 and its orthologs is unknown; however, deletion of a region of the genome that includes aec-37 affects the assimilation of seven carbohydrates, decreases growth rate of the strain in minimal medium containing galacturonate or trehalose, and attenuates the virulence of E. coli BEN2908 in chickens. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
224418	YicI	2.91e-134	1	619	177	739	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
395838	Glyco_hydro_31	6.20e-128	73	547	4	442	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
269889	GH31_GANC_GANAB_alpha	6.65e-73	89	589	1	467	neutral alpha-glucosidase C, neutral alpha-glucosidase AB. This subgroup includes the closely related glycosyl hydrolase family 31 (GH31) isozymes, neutral alpha-glucosidase C (GANC) and the alpha subunit of heterodimeric neutral alpha-glucosidase AB (GANAB). Initially distinguished on the basis of differences in electrophoretic mobility in starch gel, GANC and GANAB have been shown to have other differences, including those of substrate specificity. GANC and GANAB are key enzymes in glycogen metabolism that hydrolyze terminal, non-reducing 1,4-linked alpha-D-glucose residues from glycogen in the endoplasmic reticulum. The GANC/GANAB family includes the alpha-glucosidase II (ModA) from Dictyostelium discoideum as well as the alpha-glucosidase II (GLS2, or ROT2 - Reversal of TOR2 lethality protein 2) from Saccharomyces cerevisiae.
269890	GH31_glucosidase_II_MalA	6.19e-64	89	446	1	331	Alpha-glucosidase II-like. Alpha-glucosidase II (alpha-D-glucoside glucohydrolase) is a glycosyl hydrolase family 31 (GH31) enzyme, found in bacteria and plants, which has exo-alpha-1,4-glucosidase and oligo-1,6-glucosidase activities. Alpha-glucosidase II has been characterized in Bacillus thermoamyloliquefaciens where it forms a homohexamer. This subgroup also includes the MalA alpha-glucosidase from Sulfolobus solfataricus and the AglA alpha-glucosidase from Picrophilus torridus. MalA is part of the carbohydrate-metabolizing machinery that allows this organism to utilize carbohydrates, such as maltose, as the sole carbon and energy source.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS13517.1|GH31	5.41e-298	1	674	165	842
BBN18320.1|GH31	3.03e-229	2	646	158	812
ADH61420.1|GH31	9.41e-157	1	668	174	798
QOF67703.1|GH31	5.77e-154	1	648	171	781
AAU37146.1|GH31	1.62e-153	1	647	171	780

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5F0E_A	1.34e-52	1	593	214	768	Murine endoplasmic reticulum alpha-glucosidase II [Mus musculus],5H9O_A Complex of Murine endoplasmic reticulum alpha-glucosidase II with D-Glucose [Mus musculus],5H9O_C Complex of Murine endoplasmic reticulum alpha-glucosidase II with D-Glucose [Mus musculus],5HJO_A Murine endoplasmic reticulum alpha-glucosidase II with bound substrate analogue [Mus musculus],5HJO_C Murine endoplasmic reticulum alpha-glucosidase II with bound substrate analogue [Mus musculus],5HJR_A Murine endoplasmic reticulum alpha-glucosidase II with bound covalent intermediate [Mus musculus],5HJR_C Murine endoplasmic reticulum alpha-glucosidase II with bound covalent intermediate [Mus musculus]
5IEF_A	7.12e-51	1	593	250	823	Murine endoplasmic reticulum alpha-glucosidase II with N-butyl-1-deoxynojirimycin [Mus musculus]
5IEG_A	7.16e-51	1	593	250	823	Murine endoplasmic reticulum alpha-glucosidase II with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus]
5IED_A	7.85e-51	1	593	272	845	Murine endoplasmic reticulum alpha-glucosidase II with castanospermine [Mus musculus],5IEE_A Murine endoplasmic reticulum alpha-glucosidase II with 1-deoxynojirimycin [Mus musculus]
7KBJ_A	8.03e-51	60	593	8	508	Chain A, Neutral alpha-glucosidase AB Trypsin-cleaved Fragment #3 [Mus musculus],7KBJ_C Chain C, Neutral alpha-glucosidase AB Trypsin-cleaved Fragment #3 [Mus musculus],7KBR_A Chain A, Neutral alpha-glucosidase AB Trypsin-cleaved Fragment #3 [Mus musculus],7KBR_C Chain C, Neutral alpha-glucosidase AB Trypsin-cleaved Fragment #3 [Mus musculus],7L9E_A Chain A, Neutral alpha-glucosidase AB Trypsin-cleaved Fragment #3 [Mus musculus],7L9E_C Chain C, Neutral alpha-glucosidase AB Trypsin-cleaved Fragment #3 [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9F234|AGL2_BACTQ	6.71e-69	12	648	182	770	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1
sp|P79403|GANAB_PIG	2.83e-51	1	595	282	857	Neutral alpha-glucosidase AB OS=Sus scrofa OX=9823 GN=GANAB PE=1 SV=1
sp|Q8BVW0|GANC_MOUSE	1.37e-50	1	547	235	763	Neutral alpha-glucosidase C OS=Mus musculus OX=10090 GN=Ganc PE=1 SV=2
sp|Q8BHN3|GANAB_MOUSE	4.22e-50	1	593	282	855	Neutral alpha-glucosidase AB OS=Mus musculus OX=10090 GN=Ganab PE=1 SV=1
sp|Q8TET4|GANC_HUMAN	1.23e-49	1	547	251	779	Neutral alpha-glucosidase C OS=Homo sapiens OX=9606 GN=GANC PE=2 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000015	0.000018

TMHMM  Annotations     

There is no transmembrane helices in PHYBL_126725T0-p1.