CAZyme Information: PHYBL_123073T0-p1

Basic Information

• Species: Phycomyces blakesleeanus
• Lineage: Mucoromycota; Mucoromycetes; ; Phycomycetaceae; Phycomyces; Phycomyces blakesleeanus
• CAZyme ID: PHYBL_123073T0-p1
• CAZy Family: CE4
• CAZyme Description: Neutral trehalase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
766		89182.52	6.1381

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PblakesleeanusNRRL1555	16528	763407	0	16528

• Gene Location: location=PblaNRRL1555-_SC05:1942160-1944813(-)

Full Sequence      

MSNFPYSDHDKEVDVHAPASTYYTTGKNSRDRPRAHSRVQLEATPKPHFDTTRTRRASHD
DKNKPRRFLVDVEETQRKILEQEDTDGDFQITINDLGPKTLALGTEDSGGYRKYDIRGTY
MLSNLLQELALAHDYGRKHIVLDEARLNENPVDRLSRMIHHNFWDGLTRRIDADTIEVVC
ADPKDRSEKPVLRMYIPYDEDQQYEYYQNVADERKHLDLRVIRLPREITDEYVKSINDAP
GLLALAMKEYTDHEGKKKLKGEPFVVPGGRFNEMYGWDSYFAALGLLVDKRLDLVKSMVE
NFAYQIKHYGKILNANRSYYLARSQPPFLTDMALKVYEELPASEERENKEWLRRVLKSAI
KEYHTVWMAEPRLDKKTMLSRYHPGGIGIPPETEASHFIHIIEPFAQKHNVSVEEFDDLY
NDGKVKEPELDEYFMHDRAVRESGHDTTYRFEKVCANLATIDLNSLLYKYEMDIADAIRD
YLDDELEDFDGNKQTAEVWLERAKQRRVRIDKYLWNDKENLYFDYDTVKEKQATYESVTA
YWALWAGCASAEQAAKLARHSLAKFEVIGGLISGTEASRGQISIERPNRQWDFPFGWAPH
QMMAWVGFERYGMQDIARRLAYRWLFTITKSFVDFNGVVPEKFDVVGLTHKVEVEYGNVG
TDFKFVPREGFGWMNASYQVGLSYLNVQMRRALGTCTNPDLLFEKQLLLQGKRQSKEEMD
RAMHYRRKSEIAVHKLTEDGDLDGAVTRIVPENHPSHVDDKGFLMP

Enzyme Prediction     

EC	3.2.1.28:32

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH37	135	683	1.7e-152	0.9918533604887984

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224541	TreA	0.0	66	691	8	558	Neutral trehalase [Carbohydrate transport and metabolism].
395961	Trehalase	0.0	134	686	2	509	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
215307	PLN02567	7.47e-58	262	686	141	542	alpha,alpha-trehalase
183934	treF	2.33e-56	262	675	160	536	alpha,alpha-trehalase TreF.
183936	treA	1.02e-53	263	675	150	526	alpha,alpha-trehalase TreA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS12450.1|GH37	0.0	12	749	13	749
CDS14080.1|GH37	0.0	10	753	10	750
CDS07923.1|GH37	0.0	11	749	11	738
AAX19735.1|GH37	0.0	10	705	3	699
AAX19736.1|GH37	0.0	10	704	3	700

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JTA_A	4.28e-265	54	703	79	738	Neutral trehalase Nth1 from Saccharomyces cerevisiae [Saccharomyces cerevisiae]
5N6N_C	4.11e-264	54	703	84	743	CRYSTAL STRUCTURE OF THE 14-3-3:NEUTRAL TREHALASE NTH1 COMPLEX [Saccharomyces cerevisiae S288C]
5NIS_A	1.16e-263	71	703	6	643	Neutral trehalase Nth1 from Saccharomyces cerevisiae [Saccharomyces cerevisiae S288C]
5M4A_A	2.60e-241	121	703	3	590	Neutral trehalase Nth1 from Saccharomyces cerevisiae in complex with trehalose [Saccharomyces cerevisiae]
2JG0_A	1.07e-42	262	675	114	492	Family 37 trehalase from Escherichia coli in complex with 1- thiatrehazolin [Escherichia coli K-12],2JJB_A Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_B Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_C Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_D Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2WYN_A Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_B Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_C Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_D Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O42893|TREA_SCHPO	3.64e-294	17	703	24	716	Cytosolic neutral trehalase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ntp1 PE=1 SV=1
sp|O42783|TREB_NEUCR	7.14e-284	12	697	19	723	Cytosolic neutral trehalase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=treB PE=2 SV=2
sp|O42622|TREB_MAGO7	2.87e-281	1	700	1	718	Cytosolic neutral trehalase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=NTH1 PE=2 SV=2
sp|A0A384JRP0|TREA_BOTFB	1.20e-280	12	697	16	716	Cytosolic neutral trehalase OS=Botryotinia fuckeliana (strain B05.10) OX=332648 GN=TRE1 PE=3 SV=1
sp|O42777|TREB_EMENI	1.83e-278	54	711	74	741	Cytosolic neutral trehalase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=treB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999028	0.000988

TMHMM  Annotations     

There is no transmembrane helices in PHYBL_123073T0-p1.