CAZyme Information: PHYBL_120119T0-p1

Basic Information

• Species: Phycomyces blakesleeanus
• Lineage: Mucoromycota; Mucoromycetes; ; Phycomycetaceae; Phycomyces; Phycomyces blakesleeanus
• CAZyme ID: PHYBL_120119T0-p1
• CAZy Family: CE4
• CAZyme Description: Neutral trehalase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
614		69510.53	5.1704

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PblakesleeanusNRRL1555	16528	763407	0	16528

• Gene Location: location=PblaNRRL1555-_SC45:132207-134446(-)

Full Sequence      

MRLSFISGVALLQLGIAVTNAATSHQQSNTKGFPSCDSPIYCEGPLLRAVQLAELFPDSK
TFPTSKPVDKVLSIFDSIGGSNATKDELRVFVNENFLSAGSDLNKLNMTIPKPLPWVNEI
QDDEYKNWIEYLHQAWGDLIFEFNTAGLCDGCVSSTLPAKLPFVVPGGRFREFYYWDSFF
VIKGLLLSNQNELAKGMIENFLDFIQEYGFIPNGARIYYLNRSQPPFLVEMVRAYYETTG
DDSFVKKALPTLDKEYTFWIGNTTVSIADSVSGKRYQLNRYNVENTSPRPESYAEDYKTA
YDGTNFTTTQVIDLFSDLAAGAESGWDYSSRWSKNRIPEVGDKNGYAILRTLNTRNIVPV
DLNALLWSMESNLAEWHTKYGGRSSRSAKRANYYKKQANKRLDAMEKILWNDEEHMFCDY
NLTSKTQAIEFSPASMYPFWLNAIPERVKSPKHLTHVFDQVRDALSKYPGILTTSLFNTT
MQWDWPNGWPPLQYITMQAMLNVDNLLNKQNHKDDTILPMMYTLAERNVATAFCSWYKTG
GKIPGLLSKYPGATDDGHMFEKFDVTNIGGAGSGGEYTVQIGFGWTNGVTMWLFELFPNM
TAPDCESSVTYNLS

Enzyme Prediction     

EC	3.2.1.28:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH37	56	595	2.2e-149	0.9918533604887984

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395961	Trehalase	1.01e-152	54	598	1	509	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
215307	PLN02567	1.14e-130	41	597	13	544	alpha,alpha-trehalase
237326	treA	2.40e-103	15	607	22	545	alpha,alpha-trehalase TreA.
224541	TreA	8.06e-98	38	597	53	552	Neutral trehalase [Carbohydrate transport and metabolism].
183936	treA	4.43e-96	4	602	10	541	alpha,alpha-trehalase TreA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS03696.1|GH37	2.71e-241	35	611	29	600
CDS07813.1|GH37	1.39e-239	8	606	5	576
UJO12022.1|GH37	4.35e-150	36	606	27	634
SMR59387.1|GH37	5.57e-149	36	597	27	623
SMQ54948.1|GH37	2.49e-147	36	597	27	623

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2JG0_A	1.71e-85	44	596	15	501	Family 37 trehalase from Escherichia coli in complex with 1- thiatrehazolin [Escherichia coli K-12],2JJB_A Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_B Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_C Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_D Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2WYN_A Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_B Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_C Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_D Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12]
2JF4_A	8.38e-81	44	596	15	501	Family 37 trehalase from Escherichia coli in complex with validoxylamine [Escherichia coli K-12]
5Z66_A	8.62e-81	38	607	46	548	Structure of periplasmic trehalase from Diamondback moth gut bacteria complexed with validoxylamine [Enterobacter cloacae],5Z6H_A Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae],5Z6H_B Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae]
7E9U_A	5.57e-72	86	595	77	552	Chain A, Trehalase [Arabidopsis thaliana],7E9U_B Chain B, Trehalase [Arabidopsis thaliana]
7E9X_A	7.97e-71	86	595	77	552	Chain A, Trehalase [Arabidopsis thaliana],7E9X_B Chain B, Trehalase [Arabidopsis thaliana],7E9X_C Chain C, Trehalase [Arabidopsis thaliana],7E9X_D Chain D, Trehalase [Arabidopsis thaliana],7EAW_A Chain A, Trehalase [Arabidopsis thaliana],7EAW_B Chain B, Trehalase [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q54QZ5|TREA_DICDI	7.26e-132	32	597	45	585	Trehalase OS=Dictyostelium discoideum OX=44689 GN=treh PE=3 SV=1
sp|P19813|TREA_RABIT	1.66e-108	34	597	26	549	Trehalase OS=Oryctolagus cuniculus OX=9986 GN=TREH PE=1 SV=1
sp|O43280|TREA_HUMAN	1.91e-108	34	597	26	550	Trehalase OS=Homo sapiens OX=9606 GN=TREH PE=1 SV=2
sp|Q9JLT2|TREA_MOUSE	1.22e-107	34	597	23	547	Trehalase OS=Mus musculus OX=10090 GN=Treh PE=1 SV=1
sp|Q8MMG9|TREA_PIMHY	1.57e-107	36	604	45	578	Trehalase OS=Pimpla hypochondriaca OX=135724 GN=tre1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000194	0.999774	CS pos: 21-22. Pr: 0.9815

TMHMM  Annotations     

There is no transmembrane helices in PHYBL_120119T0-p1.