CAZyme Information: PHYBL_116472T0-p1

Basic Information

• Species: Phycomyces blakesleeanus
• Lineage: Mucoromycota; Mucoromycetes; ; Phycomycetaceae; Phycomyces; Phycomyces blakesleeanus
• CAZyme ID: PHYBL_116472T0-p1
• CAZy Family: CE20
• CAZyme Description: Mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
610		70090.28	8.2234

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PblakesleeanusNRRL1555	16528	763407	0	16528

• Gene Location: location=PblaNRRL1555-_SC22:319284-321670(-)

Full Sequence      

RVLLIIRCASALYRTIADCDEVFNYWEPLHYLQNGYGFETWEYSPEFSIRSWAYVALHAI
VGLFGKIFVSSKLQSFYLLRMALGAFSSFAEAKFYRTVTEEVNPHVGRYILAILFFSAGM
FNASTALLPSTFAMYTTFLAYSYILRPPNHIERERTYKAVFWLGMGALVGWPFSAVVGIP
FAIEEILVFGRDTTTKKDGTIIQVLRSPNWRIHRLVRLVEAIILCGAAISIPVILIDRLF
YQRWTFVPFNIVLYNVFGGEGRGPELYGTEPWYYYIVNGFLNFNIVFILALGSALCVFVT
AYIDRNRIPGTRKIDVIWPYVLLGLKLIPFYIWFAIFSLQPHKEERFLFVAYPLIALNGA
ISLYLIRSWASRVAGYFGAKVETRAAVLRYTSLAVLIVFALLSVSRILAVITRYSAPLKI
FGSIWDERAPDQLFNLDYLQEDYPTDLSKKTMNLCVGKEWHRFPSNFFMPSDVRVRFIKS
DFDGALPKTFVEDIGASSYLEVDGQRVEYRPRFYKFEGASAIQPFNDLNKADPSVYVPLS
ECDYLVDSDFPLRPLSVNEPPYVQDTATWETMDCYPFLDAQNSHQLARAFWIPDSQGLKW
GSYCLLKKRQ

Enzyme Prediction     

EC	2.4.1.259:12	2.4.1.261:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT22	2	470	7.3e-97	0.9897172236503856

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
281842	Glyco_transf_22	6.17e-92	2	470	5	414	Alg9-like mannosyltransferase family. Members of this family are mannosyltransferase enzymes. At least some members are localized in endoplasmic reticulum and involved in GPI anchor biosynthesis.
215437	PLN02816	1.29e-05	235	442	256	426	mannosyltransferase
224720	ArnT	0.010	2	372	16	346	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDS10509.1|GT22	1.66e-244	73	609	1	537
CCA67749.1|GT22	3.86e-152	1	610	64	673
QRW22284.1|GT22	7.57e-148	1	610	55	690
CDR38237.1|GT22	9.30e-144	1	609	70	687
QQK41858.1|GT22	1.55e-141	4	609	37	587

PDB Hits     

PHYBL_116472T0-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9P7Q9|ALG9_SCHPO	6.44e-124	2	609	20	560	Alpha-1,2-mannosyltransferase alg9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=alg9 PE=3 SV=1
sp|Q8VDI9|ALG9_MOUSE	4.95e-116	3	610	65	601	Alpha-1,2-mannosyltransferase ALG9 OS=Mus musculus OX=10090 GN=Alg9 PE=2 SV=1
sp|Q9H6U8|ALG9_HUMAN	1.08e-114	3	610	65	601	Alpha-1,2-mannosyltransferase ALG9 OS=Homo sapiens OX=9606 GN=ALG9 PE=1 SV=2
sp|P54002|ALG9_CAEEL	1.35e-87	1	593	58	583	Alpha-1,2-mannosyltransferase algn-9 OS=Caenorhabditis elegans OX=6239 GN=algn-9 PE=1 SV=2
sp|P53868|ALG9_YEAST	4.17e-75	16	608	28	549	Alpha-1,2-mannosyltransferase ALG9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ALG9 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.934450	0.065549

TMHMM  Annotations     

Start	End
106	128
167	189
214	236
281	303
316	338
348	370
390	412