CAZyme Information: PHYBL_116328T0-p1

Basic Information

• Species: Phycomyces blakesleeanus
• Lineage: Mucoromycota; Mucoromycetes; ; Phycomycetaceae; Phycomyces; Phycomyces blakesleeanus
• CAZyme ID: PHYBL_116328T0-p1
• CAZy Family: GT8
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
224	PblaNRRL1555-_SC21|CGC3	24772.88	5.6821

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PblakesleeanusNRRL1555	16528	763407	0	16528

• Gene Location: location=PblaNRRL1555-_SC21:770826-771663(+)

Full Sequence      

MLFYPLALLSLALTAVQARTIGVDVSALTSTASYTCIKNLGYDYAIIRCYTEAYGNNPVI
DSNCYQNYLNAKAAGISKIDIYMFPCTGRSTCKSAATQVNELVSYVGTNKMIVGRLWFDV
EIDSAANNWPSTTTSRTTLAAFHSAWSATGWKWGIYASYYQWQTITGSASYVLDSSLPLW
YPHYDEVLAFSDFTPFGGWTTPTLKQYAGDQTFCSAGFDKNYAP

Enzyme Prediction     

EC	3.2.1.17:3

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119378	GH25_Lys1-like	6.11e-68	20	222	1	195	Lys-1 is a lysozyme encoded by the Caenorhabditis elegans lys-1 gene. This gene is one of a several lysozyme genes upregulated upon infection by the Gram-negative bacterial pathogen Serratia marcescens. Lys-1 contains a glycosyl hydrolase family 25 (GH25) catalytic domain. This family also includes Lys-5 from Caenorhabditis elegans.
119373	GH25_muramidase	9.99e-14	22	210	2	171	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
119376	GH25_LytC-like	1.51e-09	22	199	3	170	The LytC lysozyme of Streptococcus pneumoniae is a bacterial cell wall hydrolase that cleaves the beta1-4-glycosydic bond located between the N-acetylmuramoyl-N-glucosaminyl residues of the cell wall polysaccharide chains. LytC is composed of a C-terminal glycosyl hydrolase family 25 (GH25) domain and an N-terminal choline-binding module (CBM) consisting of eleven homologous repeats that specifically recognizes the choline residues of pneumococcal lipoteichoic and teichoic acids. This domain arrangement is the reverse of the major pneumococcal autolysin, LytA, and the CPL-1-like lytic enzymes of the pneumococcal bacteriophages, in which the CBM (consisting of six repeats) is at the C-terminus. This model represents the C-terminal catalytic domain of the LytC-like enzymes.
119385	GH25_Lyc-like	6.14e-06	22	186	2	149	Lyc muramidase is an autolytic lysozyme (autolysin) from Clostridium acetobutylicum encoded by the lyc gene. Lyc has a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNJ46208.1|GH25|3.2.1.17	1.99e-109	7	222	9	227
QNJ46226.1|GH25|3.2.1.17	1.63e-104	14	222	18	230
CDS02619.1|GH25	1.49e-99	2	222	4	226
QNJ46258.1|GH25|3.2.1.17	5.98e-49	6	221	8	223
QNJ46257.1|GH25|3.2.1.17	3.83e-47	6	221	8	223

PDB Hits     

PHYBL_116328T0-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q27650|LYS4_ENTHI	1.19e-44	21	224	2	198	Lysozyme OS=Entamoeba histolytica OX=5759 GN=LYS4 PE=1 SV=2
sp|Q86KC1|LYSG2_DICDI	5.71e-43	1	224	1	212	Probable GH family 25 lysozyme 2 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0274181 PE=3 SV=1
sp|Q20967|LYS5_CAEEL	1.97e-41	16	224	15	215	Lysozyme-like protein 5 OS=Caenorhabditis elegans OX=6239 GN=lys-5 PE=2 SV=1
sp|Q54BL8|LYSG5_DICDI	2.78e-35	21	222	22	214	Probable GH family 25 lysozyme 5 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0293566 PE=3 SV=1
sp|Q54BQ8|LYSG4_DICDI	3.80e-31	22	224	22	212	Probable GH family 25 lysozyme 4 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0293492 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000203	0.999772	CS pos: 18-19. Pr: 0.9807

TMHMM  Annotations     

There is no transmembrane helices in PHYBL_116328T0-p1.