CAZyme Information: PHYBL_108959T0-p1

Basic Information

• Species: Phycomyces blakesleeanus
• Lineage: Mucoromycota; Mucoromycetes; ; Phycomycetaceae; Phycomyces; Phycomyces blakesleeanus
• CAZyme ID: PHYBL_108959T0-p1
• CAZy Family: AA6
• CAZyme Description: Chitin synthase/hyaluronan synthase (glycosyltransferases)

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
872	PblaNRRL1555-_SC05|CGC5	98511.13	8.9565

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PblakesleeanusNRRL1555	16528	763407	0	16528

• Gene Location: location=PblaNRRL1555-_SC05:983691-987157(-)

Full Sequence      

MTLKNGSPSGVNSTDPGDRHPPIHSSSSNSPLPQPQPHPHPNPHTHLQPQPQPQHQQQPA
RSTSRNLFSSRIPYFSAPIAASHTPRPTDESLGLQNPGRASVTTLVESSPQHQQQTLKSH
PVTVPKSRRYATRRIQLTRGNLVLDCPVPDRLLKAVARKEEEFSTMRYTAATCEPDDFQS
RGYTLRPQLYNRQTELFIVMTMYNEDEILFTRTMHGVMKNIAHLCSLQNSSMWGPDGWKK
VVVSIVADGRKIINKRVLSVLASMGVYQSGIAKNMVDNKHVTAHIYEFTTQISIDPELKL
KGIDKGIVPVQIMFCLKEKNAKKINSHRWFFSAFGPLLQPNICVLLDVGTRPGYSSIYQL
WKTFDRNPNVGGACGEIRAMLGPVFSYLLNPLVAAQNFEYKMSNILDKPLESVFGYISVL
PGAFSAYRYQALLNDINGHGPLEKYFKGENLGSQDGADEKSGLFEANMYLAEDRILCFEL
VAKRNERWLLHYCNSAFAETDVPDQLAEFISQRRRWLNGSFFAGVYGLWHFKSIWTSRHS
FTRVFLLSIEGIYNVINLIFSWLTIGNFYITFYFITKSLANPDVDPFGQGWGARIFDMLR
YFYMFLIFLLFICSMGNRPQGSKWLFVGSLIAFSVIMCYMMFASSWVIYKGIQNASETIG
WTNSLNTNVGLVFENTGLRNMIVSLAATYGLYFVSSLLYGQPWHMFTSFLPYLLLLPGYV
NILNIYAFCNTHDVSWGTKGDNSVAKDLGVVKVSDNKQQTVEVELPAEQRDVNIEFEEAL
LTLDAKVPIEKGSGNKSKEDYHRSFRTHLVLAWIASNALLVAFVTSTPFSTIYVESVGTT
YMSVILWVNAGLSAFRFIGSMMYLVLRLFTST

Enzyme Prediction     

EC	2.4.1.16:26	2.4.1.16:26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	202	364	1.8e-76	0.9938650306748467

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396286	Chitin_synth_1	1.10e-112	202	364	1	163	Chitin synthase. This region is found commonly in chitin synthases classes I, II and III. Chitin a linear homopolymer of GlcNAc residues, it is an important component of the cell wall of fungi and is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases.
133033	Chitin_synth_C	3.19e-95	198	523	1	244	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
400626	Chitin_synth_1N	3.67e-39	134	201	1	70	Chitin synthase N-terminal. This is the N-terminal domain of Chitin synthase (pfam01644).
224136	BcsA	3.21e-27	313	679	115	438	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	9.32e-14	306	434	49	168	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAA67797.1|GT2|2.4.1.16	0.0	128	871	100	851
CDS09401.1|GT2	0.0	95	871	25	804
CDS10052.1|GT2	0.0	123	869	144	904
CDS05079.1|GT2	0.0	128	870	123	863
CDS03137.1|GT2	0.0	128	870	91	832

PDB Hits     

PHYBL_108959T0-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12632|CHS1_MUCCL	0.0	128	871	100	851	Chitin synthase 1 OS=Mucor circinelloides f. lusitanicus OX=29924 GN=CHS1 PE=3 SV=1
sp|P87073|CHS1_PHYB8	2.42e-318	128	869	98	839	Chitin synthase 1 OS=Phycomyces blakesleeanus (strain ATCC 8743b / DSM 1359 / FGSC 10004 / NBRC 33097 / NRRL 1555) OX=763407 GN=chs1 PE=3 SV=1
sp|P30594|CHS1_RHIOL	3.71e-315	126	870	111	857	Chitin synthase 1 OS=Rhizopus oligosporus OX=4847 GN=CHS1 PE=3 SV=1
sp|P30595|CHS2_RHIOL	1.13e-311	128	870	115	857	Chitin synthase 2 OS=Rhizopus oligosporus OX=4847 GN=CHS2 PE=3 SV=1
sp|P30597|CHS1_SCHPO	3.27e-275	128	870	119	857	Chitin synthase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=chs1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000049	0.000000

TMHMM  Annotations     

Start	End
516	533
553	575
590	612
624	646
677	699
706	728
810	832
844	866