CAZyme Information: PHPALM_9871-t46_1-p1

Basic Information

• Species: Phytophthora palmivora
• Lineage: Oomycota; NA; ; Peronosporaceae; Phytophthora; Phytophthora palmivora
• CAZyme ID: PHPALM_9871-t46_1-p1
• CAZy Family: PL1|PL1
• CAZyme Description: Hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
241		25277.74	9.1172

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_Ppalmivorasbr112.9	28185	N/A	3511	24674

• Gene Location: location=NCKW01005200:1-723(-)

Full Sequence      

MVRVHLALAAALALIANCASAFTVGTPDGLAAGATGGANGKTVYPTSNSELVSYLSSSDP
LVIVLNKTFDFRGTEGTVTETGCRPDYTRECMAKNNGYKSQDVIIQGGNMATTGGCTGGT
KVKVTYDKAALKRMTVLGNKTIRGIGKSGVIKGKGLTLAGDNIIVQNIHITELNHHLVWG
GDAIYMQGTNGGSTAMKKIWLDHIKISKVGRQFITTNKASTDSMTISNSDFDGNTDYSAS
C

Enzyme Prediction     

EC	4.2.2.10:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	123	241	4.8e-48	0.5989304812834224

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	1.78e-16	123	233	1	113	Amb_all domain.
226384	PelB	1.62e-07	97	241	51	204	Pectate lyase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACR19258.1|PL1_4	1.03e-149	1	241	1	241
AHX74069.1|PL1_4	9.69e-115	1	241	1	241
ADN18834.1|PL1_4	2.14e-114	8	241	8	241
AHX74068.1|PL1_4	3.03e-114	8	241	8	241
ADN18835.1|PL1_4	3.91e-114	1	241	1	241

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QCX_A	4.72e-48	24	241	4	206	Pectin Lyase B [Aspergillus niger]
1IDJ_A	9.84e-38	25	241	5	206	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]
1IDK_A	1.93e-37	25	241	5	206	Pectin Lyase A [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CZD4|PELF2_ASPTN	5.68e-52	1	241	1	226	Probable pectin lyase F-2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pelF-2 PE=3 SV=1
sp|Q2UJA7|PELF_ASPOR	2.10e-51	1	241	1	227	Probable pectin lyase F OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pelF PE=3 SV=2
sp|B8N316|PELF_ASPFN	2.10e-51	1	241	1	227	Probable pectin lyase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pelF PE=3 SV=1
sp|Q00374|PELA_COLGL	5.51e-51	8	241	7	227	Pectin lyase OS=Colletotrichum gloeosporioides OX=474922 GN=PNLA PE=3 SV=1
sp|Q5BA61|PELB_EMENI	8.27e-50	3	241	2	225	Pectin lyase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pelB PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000393	0.999569	CS pos: 21-22. Pr: 0.8986

TMHMM  Annotations     

There is no transmembrane helices in PHPALM_9871-t46_1-p1.